HPA003185

Anti-MED12 antibody produced in rabbit

Ab2, Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-ARC240 antibody produced in rabbit, Anti-Activator-recruited cofactor 240 kDa component antibody produced in rabbit, Anti-CAG repeat protein 45 antibody produced in rabbit, Anti-Mediator of RNA polymerase II transcription subunit 12 antibody produced in rabbit, Anti-OPA-containing protein antibody produced in rabbit, Anti-Thyroid hormone receptor-associated protein complex 230 kDa component antibody produced in rabbit, Anti-Trap230 antibody produced in rabbit
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA003185
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; IHC; WB
• klón: polyclonal
• faj reaktivitás: human
• citations: 4
• technika/technikák: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50; western blot: 0.04-0.4 μg/mL

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• faj reaktivitás: human
• fejlettebb validálás: orthogonal RNAseq; independent; RNAi knockdown; Learn more about Antibody Enhanced Validation
• technika/technikák: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:20-1:50; western blot: 0.04-0.4 μg/mL
• immunogén szekvencia: LPTTMTGVMGLEPSSYKTSVYRQQQPAVPQGQRLRQQLQAKIQSQGMLGQSSVHQMTPSSSYGLQTSQGYTPYVSHVGLQQHTGPAGTMVPPSYSSQPYQSTHPSTNPTLVDPTRHLQQRPSGYVHQQAPTYGHGLTS
• UniProt elérési szám: Q93074
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... MED12(9968)

Leírás

Immunogén

Mediator of RNA polymerase II transcription subunit 12 recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Biokémiai/fiziológiai hatások

MED12 (mediator complex subunit 12) gene encodes a component of the multiprotein complex ARC/Mediator complex and functions as a coactivator in the regulated transcription of most RNA polymerase II-dependent genes. It is involved in the regulation of transcription of genes that are activated by Wnt signaling pathway. It recruits transcription factor IIB during preinitiation complex assembly and promotes basal transcription. It is involved in the regulation of Gli3-dependent sonic hedgehog signaling processes. Mutations in this gene have been observed in benign and malignant uterine leiomyomas.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST74446

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)