AV35300

Anti-NMUR2 antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-Neuromedin U receptor 2
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 46 kDa
• faj reaktivitás: human
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• NCBI elérési szám: NP_064552
• UniProt elérési szám: Q9GZQ4
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... NMUR2(56923)

Leírás

Általános leírás

NMUR2 (neuromedin U receptor 2) belongs to the G-protein coupled receptor family. It is known to mediate anti-obesity effects by regulating food intake and body weight.
Rabbit Anti-NMUR2 antibody recognizes human NMUR2.

Immunogen

Synthetic peptide directed towards the N terminal region of human NMUR2

Alkalmazás

Rabbit Anti-NMUR2 antibody is suitable for western blot applications at a concentration of 0.25 μg/ml.

Biokémiai/fiziológiai hatások

NMUR2 encodes for one of two G-protein-coupled receptors for the neuropeptide, neuromedin U. This peptide is found in highest levels in the gut and genitourinary system where it potently contracts smooth muscle but is also expressed in the spinal cord and discrete regions of the brain. NMUR2 is highly expressed in the central nervous system.

Szekvencia

Synthetic peptide located within the following region: MSGMEKLQNASWIYQQKLEDPFQKHLNSTEEYLAFLCGPRRSHFFLPVSV

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 2
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable