AV32386
Anti-SIRT1 antibody produced in rabbit
affinity isolated antibody
Szinonimák:
Anti-Sirtuin (silent mating type information Regulation 2 homolog) 1 (S. cerevisiae)
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(4)
About This Item
UNSPSC kód:
12352203
NACRES:
NA.41
konjugátum:
unconjugated
application:
WB
klón:
polyclonal
faj reaktivitás:
rabbit, horse, guinea pig, rat, human, bovine, dog, mouse
citations:
5
technika/technikák:
western blot: suitable
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
Forma
buffered aqueous solution
molekulatömeg
82 kDa
faj reaktivitás
rabbit, horse, guinea pig, rat, human, bovine, dog, mouse
koncentráció
0.5 mg - 1 mg/mL
technika/technikák
western blot: suitable
NCBI elérési szám
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SIRT1(23411)
Általános leírás
Rabbit polyclonal anti-SIRT1 antibody reacts with chicken, human, mouse, rat, canine, and pig sirtuin-1 enzymes.
Sirtuin (silent mating type information regulation 2 homolog) 1 (S. cerevisiae) (SIRT1), a member of the NAD(+)-dependent protein deacetylase SIRT family, is involved in the regulation of nuclear transcription of genes involve in energy metabolism. SIRT1 provides a link between cellular energy status sensing (NAD(+) status) and the regulation of energy homoeostasis. SIRT1 is involved in the regulation of metabolism, cell differentiation and senescence, stress response, and cancer.
Immunogén
Synthetic peptide directed towards the N terminal region of human SIRT1
Alkalmazás
Rabbit Anti-SIRT1 antibody can be used for western blot applications at a concentration of 0.5μg/ml.
Rabbit polyclonal anti-SIRT1 antibody is used to tag sirtuin-1 for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of sirtuin-1 in NAD(+) status-dependent energy homeostasis at the level of nuclear transcription control and protein deacetylation.
Biokémiai/fiziológiai hatások
SIRT1 is a member of the sirtuin family of proteins, homologs to the yeast Sir2 protein. Members of the sirtuin family are characterized by a sirtuin core domain and grouped into four classes. The functions of human sirtuins have not yet been determined;
Szekvencia
Synthetic peptide located within the following region: PETIPPPELDDMTLWQIVINILSEPPKRKKRKDINTIEDAVKLLQECKKI
Fizikai forma
Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 3
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Éverton Lopes Vogt et al.
International journal of environmental research and public health, 18(14) (2021-07-25)
Introduction and objectives: Obesity represents a major global public health problem. Its etiology is multifactorial and includes poor dietary habits, such as hypercaloric and hyperlipidic diets (HFDs), physical inactivity, and genetic factors. Regular exercise is, per se, a tool for
Yan Li et al.
International journal of molecular medicine, 41(6), 3517-3526 (2018-03-14)
Mitochondrial dynamics have critical roles in aging, and their impairment represents a prominent risk factor for myocardial dysfunction. Mitochondrial deacetylase sirtuin (SIRT)3 contributes greatly to the prevention of redox stress and cell aging. The present study explored the role of SIRT3
Moez Eid et al.
Frontiers in physiology, 13, 782684-782684 (2022-05-17)
Sirtuins (SIRTs) are NAD+- dependent histone deacetylases. They are involved in a variety of biological pathways and are thought to be a promising target for treating several human disorders. Although evidence is piling up to support the neuroprotective role of
Svetlana Demyanenko et al.
Journal of stroke and cerebrovascular diseases : the official journal of National Stroke Association, 29(10), 105152-105152 (2020-09-12)
Sirtuins, class III histone deacetylases, are involved in the regulation of tissue repair processes and brain functions after a stroke. The ability of some isoforms of sirtuins to circulate between the nucleus and cytoplasm may have various pathophysiological effects on
Knut H Lauritzen et al.
Neurobiology of aging, 48, 34-47 (2016-09-18)
Mitochondrial genome maintenance plays a central role in preserving brain health. We previously demonstrated accumulation of mitochondrial DNA damage and severe neurodegeneration in transgenic mice inducibly expressing a mutated mitochondrial DNA repair enzyme (mutUNG1) selectively in forebrain neurons. Here, we
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással