AV30475

Anti-BCL2L1 antibody produced in rabbit

IgG fraction of antiserum

• Szinonimák: Anti-BCL-XL/S, Anti-BCL2-like 1, Anti-BCL2L, Anti-BCLX, Anti-Bcl-X, Anti-Bcl-xL, Anti-Bcl-xS, Anti-DKFZp781P2092
• MDL-szám: MFCD00675212
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: IgG fraction of antiserum
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 26 kDa
• faj reaktivitás: sheep, rabbit, horse, pig, human, bovine, dog
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• NCBI elérési szám: NP_612815
• UniProt elérési szám: Q07817
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... BCL2L1(598)

Leírás

Általános leírás

BCL2L1 is a signaling molecule that is known to regulate neuronal apoptosis. Furthermore, BCL2L1 can facilitate the survival of retinal ganglion cells.
Rabbit Anti-BCL2L1 associates with rabbit, rat, bovine, canine, pig, mouse, and human BCL2L1.

Immunogen

Synthetic peptide directed towards the N terminal region of human BCL2L1

Alkalmazás

Rabbit Anti-BCL2L1 antibody can be used for western blot (2.5μg/ml) assays.

Biokémiai/fiziológiai hatások

BCL2L1 encodes a protein which belongs to the BCL-2 protein family. The proteins encoded by BCL2L1 are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis.The protein encoded by this gene belongs to the BCL-2 protein family. BCL-2 family members form hetero- or homodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. The proteins encoded by this gene are located at the outer mitochondrial membrane, and have been shown to regulate outer mitochondrial membrane channel (VDAC) opening. VDAC regulates mitochondrial membrane potential, and thus controls the production of reactive oxygen species and release of cytochrome C by mitochondria, both of which are the potent inducers of cell apoptosis. Two alternatively spliced transcript variants, which encode distinct isoforms, have been reported. The longer isoform acts as an apoptotic inhibitor and the shorter form acts as an apoptotic activator.

Szekvencia

Synthetic peptide located within the following region: SNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESEMETPSAING

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable