06-847
Anti-EGFR Antibody
Upstate®, from rabbit
Szinonimák:
Receptor tyrosine-protein kinase ErbB-1, avian erythroblastic leukemia viral (v-erb-b) oncogene homolog, cell growth inhibiting protein 40, cell proliferation-inducing protein 61, epidermal growth factor receptor, epidermal growth factor receptor (avian
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(2)
About This Item
UNSPSC kód:
12352203
eCl@ss:
32160702
NACRES:
NA.41
klón:
polyclonal
application:
IP
WB
WB
faj reaktivitás:
rat, hamster, mouse, human
technika/technikák:
immunoprecipitation (IP): suitable
western blot: suitable
western blot: suitable
citations:
100
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
antitest forma
purified immunoglobulin
antitest terméktípus
primary antibodies
klón
polyclonal
faj reaktivitás
rat, hamster, mouse, human
kiszerelés
antibody small pack of 25 μg
gyártó/kereskedő neve
Upstate®
technika/technikák
immunoprecipitation (IP): suitable
western blot: suitable
izotípus
IgG
NCBI elérési szám
UniProt elérési szám
kiszállítva
ambient
célzott transzláció utáni módosítás
unmodified
Géninformáció
hamster ... Egfr(100774580)
human ... EGFR(1956)
mouse ... Egfr(13649)
rat ... Egf(25313)
Általános leírás
The epidermal growth factor receptor (EGFR; ErbB-1; HER1 in humans) is the cell-surface receptor for members of the epidermal growth factor family (EGF-family) of extracellular protein ligands. The epidermal growth factor receptor is a member of the ErbB family of receptors, a subfamily of four closely related receptor tyrosine kinases: EGFR (ErbB-1), HER2/c-neu (ErbB-2), Her 3 (ErbB-3) and Her 4 (ErbB-4). Mutations affecting EGFR expression or activity could result in cancer. EGFR (epidermal growth factor receptor) exists on the cell surface and is activated by binding of its specific ligands, including epidermal growth factor and transforming growth factor α (TGFα). Upon activation by its growth factor ligands, EGFR undergoes a transition from an inactive monomeric form to an active homodimer. In addition to forming homodimers after ligand binding, EGFR may pair with another member of the ErbB receptor family, such as ErbB2/Her2/neu, to create an activated heterodimer. EGFR dimerization stimulates its intrinsic intracellular protein-tyrosine kinase activity. As a result, autophosphorylation of five tyrosine (Y) residues in the C-terminal domain of EGFR occurs.
Egyediség
Recognizes the EGFR, Mr 180 kDa.
Reported to detect rat and hamster.
Immunogén
Ovalbumin conjugated synthetic peptide (ETKPNGIFKGPTAENAEYLRVAPPSSEFIGA) corresponding to amino acids 1156-1186 of the processed mouse EGF receptor (EGFR) C-terminal domain (Accession number Q01279). The immunizing sequence shares 28/31 identity with the human EGF receptor sequence.
Alkalmazás
Anti-EGFR Antibody detects level of EGFR & has been published & validated for use in IP & WB.
Immunoprecipitation:
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.
4 µg of a previous lot immunoprecipitated the EGFR from 500 µg of a 3T3/A31 RIPA cell lysate.
Immunohistochemistry (Paraffin) Analysis: A 1:500 Dilution of this antibody detected EGFR in human placenta tissue sections.
Minőség
Routinely evaluated by western blot on a mouse 3T3/A31 RIPA cell lysate.
Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
Western Blot Analysis:
0.5-2 µg/mL of this lot detected the EGFR from a mouse 3T3/A31 RIPA cell lysate.
Cél megnevezése
180 kDa
Kapcsolódás
Replaces: 04-337; 04-338
Fizikai forma
Format: Purified
Purified rabbit polyclonal IgG in buffer containing 0.1M Tris-Glycine, 0.15M NaCl, 0.05% Sodium Azide, pH 7.4. Store at 2-8°C.
Tárolás és stabilitás
Stable for 1 year at 2-8°C from date of receipt.
Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.
Handling Recommendations: Upon first thaw,
and prior to removing the cap, centrifuge the
vial and gently mix the solution.
Analízis megjegyzés
Control
Positive Antigen Control: Catalog #12-305, 3T3/A31 lysate. Add 2.5 μL of 2-mercapto-ethanol/100 μL of lysate and boil for 5 minutes to reduce the preparation. Load 20 μg of reduced lysate per lane for minigels.
Positive Antigen Control: Catalog #12-305, 3T3/A31 lysate. Add 2.5 μL of 2-mercapto-ethanol/100 μL of lysate and boil for 5 minutes to reduce the preparation. Load 20 μg of reduced lysate per lane for minigels.
Egyéb megjegyzések
Concentration: Please refer to the Certificate of Analysis for the lot-specific concentration.
Jogi információk
UPSTATE is a registered trademark of Merck KGaA, Darmstadt, Germany
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
javasolt
Tárolási osztály kódja
12 - Non Combustible Liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Analitikai tanúsítványok (COA)
Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Role of the Sec61 translocon in EGF receptor trafficking to the nucleus and gene expression.
Liao, HJ; Carpenter, G
Molecular Biology of the Cell null
Thomas Kruewel et al.
PloS one, 5(11), e14143-e14143 (2010-12-15)
The non-receptor tyrosine kinases c-Abl and c-Src are overexpressed in various solid human tumours. Inhibition of their hyperactivity represents a molecular rationale in the combat of cancerous diseases. Here we examined the effects of a new family of pyrazolo [3,4-d]
Nuclear factor-kappa B activation promotes restitution of wounded intestinal epithelial monolayers.
Egan, LJ; de Lecea, A; Lehrman, ED; Myhre, GM; Eckmann, L; Kagnoff, MF
American Journal of Physiology. Cell Physiology null
Regulated intramembrane cleavage of the EGF receptor.
Hong-Jun Liao,Graham Carpenter
Traffic null
Aiwen Dong et al.
The Journal of biological chemistry, 290(13), 8016-8027 (2015-02-11)
The epidermal growth factor receptor (EGFR) is a well characterized receptor-tyrosine kinase that functions in development and serves a vital role in many human cancers. Understanding EGFR regulatory mechanisms, and hence approaches for clinical intervention, has focused on ligand-receptor interactions
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással