MSST0058

SILu^™Lite IL8, Interleukin-8 human

recombinant, expressed in HEK 293 cells, MS Protein Standard

• Sinônimo(s): C-X-C motif chemokine 8, Chemokine (C-X-C motif), Emoctakin, Granulocyte chemotactic protein 1 (GCP-1), IL-8, Monocyte-derived neutrophil, Monocyte-derived neutrophil-activating peptide (MONAP), Neutrophil-activating protein 1 (NAP-1), Protein 3-10C, T-cell chemotactic factor, chemotactic factor (MDNCF), ligand 8
• Código UNSPSC: 23201100
• NACRES: NA.32

Propriedades

• recombinante: expressed in HEK 293 cells
• Nível de qualidade: 200
• Ensaio: ≥95% (SDS-PAGE)
• Formulário: lyophilized powder
• adequação: suitable for mass spectrometry (internal calibrator)
• nº de adesão UniProt: P10145
• Condições de expedição: ambient
• temperatura de armazenamento: −20°C
• Informações sobre genes: human ... CXCL8(3576)

Descrição

Descrição geral

SILu^™Lite IL8 is a recombinant human protein expressed in human 293 cells. It is a mixture of the 3 main CXCL8 isoforms with the molecular weights, amino acid number and relative abundance as described in Table 1 of the product datasheet. SILu^™Lite IL8 is an analytical standard designed to be used as starting material for preparation of calibrators and controls in LC-MS applications.

Ações bioquímicas/fisiológicas

Interleukin-8 (IL-8) is a member of the CXC chemokine subfamily and is produced by blood cells and many types of tissues. The measurement of IL-8 in voided urinary samples may have utility for urine-based detection of bladder cancer. Urinary IL-8 was a strong biomarker of stress under intensive and prolonged demands, both acutely and over time. IL-8 and cathepsin B levels were significantly elevated in melanoma patients, and more importantly, the combination of IL-8 and cathepsin B were also studied as a prognosis marker for melanoma mortality.

Sequência

EGAVLPRSAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

forma física

Supplied as a lyophilized powder containing phosphate buffered saline.

Informações legais

SILu is a trademark of Sigma-Aldrich Co. LLC

Informações de segurança

• Código de classe de armazenamento: 11 - Combustible Solids
• Classe de risco de água (WGK): WGK 2
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable