AV32439

Anti-OTX2 antibody produced in rabbit

affinity isolated antibody

• Sinônimo(s): Anti-Orthodenticle homeobox 2
• Código UNSPSC: 12352203
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• Formulário: buffered aqueous solution
• peso molecular: 32 kDa
• reatividade de espécies: human, bovine, dog, guinea pig, horse, rabbit, sheep, mouse, rat
• concentração: 0.5 mg - 1 mg/mL
• técnica(s): immunohistochemistry: suitable; western blot: suitable
• nº de adesão NCBI: NP_068374
• nº de adesão UniProt: P32243-2
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... OTX2(5015)

Descrição

Descrição geral

OTX2 is a homeodomain transcription factor that regulates organ development. Studies in mice have shown that Otx2 is involved in determining the fate of retinal photoreceptor cells. This transcription factor has also been implicated in pineal gland development.
Rabbit Anti-OTX2 antibody recognizes canine, chicken, human, mouse, rat, rabbit, zebrafish, and bovine OTX2.

Imunogênio

Synthetic peptide directed towards the N terminal region of human OTX2

Aplicação

Rabbit Anti-OTX2 antibody can be used for western blot applications at a concentration of 1.0-10.0μg/ml. It can also be used for IHC applications at 4-8μg/ml.

Ações bioquímicas/fisiológicas

Homeobox protein OTX2 is a member of the bicoid sub-family of homeodomain-containing transcription factors. This protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined. This gene encodes a member of the bicoid sub-family of homeodomain-containing transcription factors. The encoded protein acts as a transcription factor and may play a role in brain and sensory organ development. A similar protein in mice is required for proper forebrain development. Two transcript variants encoding distinct isoforms have been identified for this gene. Other alternative splice variants may exist, but their full length sequences have not been determined.

Sequência

Synthetic peptide located within the following region: PESRVQVWFKNRRAKCRQQQQQQQNGGQNKVRPAKKKTSPAREVSSESGT

forma física

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 3
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable