WH0055294M2

Monoclonal Anti-FBXW7 antibody produced in mouse

clone 3D1, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-AGO, Anti-CDC4, Anti-DKFZp686F23254, Anti-F-box and WD-40 domain protein 7 (archipelago homolog, Drosophila), Anti-FBW7, Anti-FBX30, Anti-FBXW6, Anti-SEL10
• MDL-szám: MFCD09265424
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3D1, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2aκ
• GenBank elérési szám: NM_033632
• UniProt elérési szám: Q969H0
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... FBXW7(55294)

Leírás

Általános leírás

F-box and WD40 domain protein 7 (FBXW7) is a member of F-box protein family, which acts as a substrate recognition component of the ubiquitin ligase complex SCF (Skp-Cullin-F-box). The proteins have a bipartite structure. The shared F-box motif links F-box protein to Skp1 and the core complex, whereas divergent protein-protein interaction motifs selectively bind their cognate substrates. There are three FBXW7 isoforms α, β ,γ that share 10 out of 11 exons but they differ in their subcellular localization as well as in substrate recognition activity. The gene encoding FBXW7 is localized on human chromosome 4q31.3.

Immunogén

FBXW7 (NP_361014, 599 a.a. ~ 707 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
ADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGEFIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK

Alkalmazás

Monoclonal Anti-FBXW7 antibody produced in mouse has been used in Western blotting and immunohistochemistry.

Biokémiai/fiziológiai hatások

F-box proteins are associated with various signaling pathways, such as nutrient sensing in yeast, conserved developmental pathways in plants and animals. These proteins mediate recognition of phosphorylated targets including Cyclin E, Myc, c-Jun, and Notch, leading to their ubiquitination and degradation. Similar to the inactivation mode of other known tumor suppressors, the SV40 large T antigen binds F-box and WD40 domain protein 7 (FBXW7) without detectible effects on its stability, and thus acts as an inhibitor of FBXW7 activity.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: nwg
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)