WH0007103M2

Monoclonal Anti-TSPAN8 antibody produced in mouse

clone 1E5, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-CO029, Anti-TM4SF3, Anti-tetraspanin 8
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); IF; WB
• klón: 1E5, monoclonal
• faj reaktivitás: human
• citations: 1
• technika/technikák: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 1E5, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG3λ
• GenBank elérési szám: NM_004616
• UniProt elérési szám: P19075
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... TSPAN8(7103)

Leírás

Általános leírás

The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein that is known to complex with integrins. This gene is expressed in different carcinomas. The use of alternate polyadenylation sites has been found for this gene. (provided by RefSeq)

Immunogén

TSPAN8 (NP_004607, 110 a.a. ~ 205 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
KSKSDRIVNETLYENTKLLSATGESEKQFQEAIIVFQEEFKCCGLVNGAADWGNNFQHYPELCACLDKQRPCQSYNGKQVYKETCISFIKDFLAKN

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)