SAB2108655

Anti-Choline Acetyltransferase Antibody

rabbit polyclonal

• Szinonimák: Anti- CHOACTASE, Anti- CMS1A2, Anti-CMS1A
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• product name: Anti-CHAT, affinity isolated antibody
• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 70 kDa
• faj reaktivitás: dog, human, horse
• koncentráció: 0.5-1 mg/mL
• technika/technikák: immunoblotting: suitable
• elérési szám: NM_020984
• UniProt elérési szám: P28329
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CHAT(1103)

Leírás

Általános leírás

The previously assigned protein identifier A2BDF5 has been merged into P28329. Full details can be found on the UniProt database.

Immunogen

The immunogen for Anti-CHAT antibody: synthetic peptide directed towards the C terminal of human CHAT

Biokémiai/fiziológiai hatások

CHAT is an enzyme which catalyzes the biosynthesis of the neurotransmitter acetylcholine. This protein is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer disease. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.

Szekvencia

Synthetic peptide located within the following region: SSFHSCKETSSSKFAKAVEESLIDMRDLCSLLPPTESKPLATKEKATRPS

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable