SAB2102166

Anti-SLC15A2 antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-PEPT2, Anti-Solute carrier family 15 (H+/peptide transporter), member 2
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: WB
• klón: polyclonal
• faj reaktivitás: human
• technika/technikák: western blot: suitable

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 82 kDa
• faj reaktivitás: human
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• UniProt elérési szám: Q16348
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... SLC15A2(6565)

Leírás

Immunogén

Synthetic peptide directed towards the middle region of human SLC15A2

Biokémiai/fiziológiai hatások

SLC15A2 belongs to the PTR2/POT transporter (TC 2.A.17) family. It is a multi-pass membrane protein. The expression/activity of PEPT2 (SLC15A2) may be a critical factor in the modulation of opioidergic neurotransmission in vivo.

Szekvencia

Synthetic peptide located within the following region: GNENNSLLIESIKSFQKTPHYSKLHLKTKSQDFHFHLKYHNLSLYTEHSV

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable