SAB2100200

Anti-BACE1 antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-β-Site APP-cleaving enzyme 1, Anti-ASP2, Anti-BACE, Anti-FLJ90568, Anti-HSPC104
• MDL-szám: MFCD03096637
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; IHC; WB
• klón: polyclonal
• faj reaktivitás: rabbit, bovine, guinea pig, mouse, rat, horse, dog, human
• citations: 6
• technika/technikák: immunofluorescence: suitable; immunohistochemistry: suitable; western blot: suitable

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 51 kDa
• faj reaktivitás: rabbit, bovine, guinea pig, mouse, rat, horse, dog, human
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: immunofluorescence: suitable; immunohistochemistry: suitable; western blot: suitable
• UniProt elérési szám: P56817
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... BACE1(23621)

Leírás

Általános leírás

β-site APP cleaving enzyme (BACE-1) is known as β-secretase. It consists of an N-terminal signal peptide (SP), a pro-peptide (Pro) domain, a catalytic domain, a transmembrane domain and a C-terminal tail.

BACE1, a member of the peptidase A1 protein family, is a type I integral membrane glycoprotein and aspartic protease that is found mainly in the Golgi.

Immunogén

Synthetic peptide directed towards the N terminal region of human BACE1

Biokémiai/fiziológiai hatások

β-site APP cleaving enzyme (BACE-1) acts as a rate-limiting enzyme of amyloid-β-peptide (Aβ). Overexpression of BACE-1 leads to increased β-secretase activity.

Szekvencia

Synthetic peptide located within the following region: GQGYYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFLHRYYQRQLSSTY

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable