SAB1405280

Monoclonal Anti-NANOG antibody produced in mouse

clone 2E11, purified immunoglobulin, buffered aqueous solution

• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (c); ELISA (i); IF; WB
• klón: 2E11, monoclonal
• faj reaktivitás: human
• citations: 2
• technika/technikák: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2E11, monoclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~36.89 kDa
• faj reaktivitás: human
• technika/technikák: capture ELISA: suitable; indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2bκ
• NCBI elérési szám: NM_024865
• UniProt elérési szám: Q9H9S0
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... NANOG(79923)

Leírás

Immunogén

NANOG (NP_079141, 98 a.a. ~ 195 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
TRTVFSSTQLCVLNDRFQRQKYLSLQQMQELSNILNLSYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQGCLVNPTGNLPM

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable