SAB1403527

Monoclonal Anti-PARP1, (N-terminal) antibody produced in mouse

clone 2C7, purified immunoglobulin, buffered aqueous solution

• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2C7, monoclonal
• form: buffered aqueous solution
• molekulatömeg: antigen ~37 kDa
• faj reaktivitás: human
• technika/technikák: capture ELISA: suitable; immunofluorescence: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• NCBI elérési szám: BC037545
• UniProt elérési szám: P09874
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... PARP1(142)

Leírás

Általános leírás

Poly (ADP-ribose) polymerase 1 (PARP1) is a nuclear protein which possesses three functional domains. It belongs to the PARP family and the gene encoding it is localized on human chromosome 1q42.

Immunogen

PARP1 (AAH37545, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MAESSDKLYRVEYAKSGRASCKKCSESIPKDSLRMAIMVQSPMFDGKVPHWYHFSCFWKVGHSIRHPDVEVDGFSELRWDDQQKVKKTAEAGGVTGKGQD

Biokémiai/fiziológiai hatások

Poly (ADP-ribose) polymerase 1 (PARP1) has a role in DNA repair and acts as a facilitator of homologous recombination. It controls transcription by modulating chromatin structure and altering DNA methylation patterns. The protein functions as a co-regulator of transcription factors and associates with chromatin insulators. PARP1 also has an important role in protection of the cardiovascular system.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable