MSST0007

SILu^™Prot CLU Clusterin human

recombinant, expressed in HEK 293 cells, SIL MS Protein Standard, ¹³C and ¹⁵N-labeled

• Szinonimák: Apolipoprotein J, Clusterin, Testosterone-repressed prostate message 2 (TRPM-2)
• UNSPSC kód: 23201100
• NACRES: NA.12

Tulajdonságok

• biológiai forrás: human
• Minőségi szint: 200
• rekombináns: expressed in HEK 293 cells
• tag: His tagged; V5 tagged
• Teszt: ≥98% (SDS-PAGE)
• Forma: lyophilized powder
• hatékonyság: ≥98% Heavy amino acids incorporation efficiency by MS
• molekulatömeg: 56811.45
• technika/technikák: mass spectrometry (MS): suitable
• alkalmasság: suitable for mass spectrometry
• UniProt elérési szám: P10909
• tárolási hőmérséklet: −20°C
• Géninformáció: human ... CLU(1191)

Leírás

Általános leírás

SILu^™ Prot Clusterin is a recombinant, stable isotope-labeled human Clusterin which incorporates [¹³C₆, ¹⁵N₄]-Arginine and [¹³C₆, ¹⁵N₂]-Lysine. Expressed in human 293 cells, it is designed to be used as an internal standard for bioanalysis of Clusterin in mass-spectrometry. SIL^™ Prot Clusterin is a heterodimer of 2 subunits (alpha and beta) consisting of 427 amino acids (including N-terminal polyhistidine and V5 tags), with a calculated molecular weight of 50 kDa.

Biokémiai/fiziológiai hatások

Clusterin is a secreted glycosylated, 80-kDa disulfide-linked heterodimer of alpha and beta subunits (produced by internal cleavage). Clusterin is expressed in virtually all tissues and found in all human fluids. It is involved in numerous physiological processes important for carcinogenesis and tumor growth, including anti-apoptotic cell survival, cell cycle regulation, cell adhesion, tissue remodeling and lipid transportation. Clusterin also exists as a nuclear protein. The secreted form of Clusterin has extracellular chaperone and anti-apoptotic activities while the nuclear form acts as a proapoptotic factor.

Szekvencia

DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREESDPSRGPFEGKPIPNPLLGLDSTRTGHHHHHHHHGGQ

Fizikai forma

Supplied as a lyophilized powder containing phosphate buffered saline.

Jogi információk

SILu is a trademark of Sigma-Aldrich Co. LLC

Biztonsági adatok

• Tárolási osztály kódja: 13 - Non Combustible Solids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable