HPA030817

Anti-YKT6 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, ab1

• Szinonimák: Anti-YKT6 v-SNARE homolog (S. cerevisiae)
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA030817
• NACRES: NA.41
• konjugátum: unconjugated
• application: IHC
• klón: polyclonal
• faj reaktivitás: human
• citations: 8
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• faj reaktivitás: human
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:20-1:50
• immunogén szekvencia: LCHVYVRNDSLAGVVIADNEYPSRVAFTLLEKVLDEFSKQVDRIDWPVGSPATIHYPALDGHLSRYQ
• UniProt elérési szám: O15498
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... YKT6(10652)

Leírás

Általános leírás

YKT6 v-SNARE homolog (soluble N-ethylmaleimide-sensitive factor attachment protein receptor proteins) is also called synaptobrevin homolog YKT6. The gene YKT6 is located on human chromosome 7p13. The C-terminal ofYKT6 has the SNARE binding domain and the N-terminal has longin domain which adopts to profilin-like fold. Both domains are critical for functionality of YKT6.

Immunogén

YKT6 v-SNARE homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-YKT6 antibody produced in rabbit has been in western blotting.

Biokémiai/fiziológiai hatások

Synaptobrevin homolog YKT6 mobilises transport events between endoplasmic reticulum, golgi and endosomes. The longin domain of YKT6 mediates protein targeting to neurons and is critical for proper neuronal function.Palmitoylation of YKT6 is critical for its functionality. Farnesylation of YKT6 modulates its SNARE functionality and membrane association.YKT6 is highly expressed in breast and downregulated in lung cancer.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST78464

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide.

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable