Ugrás a tartalomra
Merck

HPA012672

Sigma-Aldrich

Anti-DACH1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Szinonimák:

Anti-Dach1, Anti-Dachshund homolog 1

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
Human Protein Atlas-szám:
NACRES:
NA.43

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

faj reaktivitás

human

technika/technikák

immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200

immunogén szekvencia

PKRTQSVTSPENSHIMPHSVPGLMSPGIIPPTGLTAAAAAAAAATNAAIAEAMKVKKIKLEAMSNYHASNNQHGADSENGDMNSSVGSSDGSWDKETLPSSPSQGPQASITHPRMPGARSLPLSHPLNHLQQSHLLPNGLELP

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... DACH1(1602)

Általános leírás

Dachshund homolog 1 (DACH1) contains a DS domain essential for its function. The gene encoding it is located on chromosome 13q21.

Immunogen

dachshund family transcription factor 1

Alkalmazás

Anti-DACH1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry at a dilution of 1:400. against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biokémiai/fiziológiai hatások

Dachshund homolog 1 (DACH1) plays a very important role in the proliferation of retinal and pituitary precursor cells, and also inhibits transforming growth factor-β (TGF-β) induced apoptosis. It acts as a repressor of TGF-β induction of AP-1 and Smad (transcription factors) signaling. It also represses those genes which are responsive to TGF-β. DACH1 binds to endogenous nuclear receptor co-repressor (NCoR) and inhibits the activation of reporter activity on promoters which are induced by Smad2 or Smad3. DACH1 regulates and blocks contact-independent growth, inhibits cyclin D1 and breast tumor growth. Basically, it is a cell fate determination factor.

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST71277

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Egyéni védőeszköz

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

DACH1 is a cell fate determination factor that inhibits cyclin D1 and breast tumor growth.
K Wu
Molecular and Cellular Biology, 26(19), 7116-7129 (2006)
Janine Vonlanthen et al.
BMC cancer, 14, 46-46 (2014-01-30)
Biological processes are controlled by transcription networks. Expression changes of transcription factor (TF) genes in precancerous lesions are therefore crucial events in tumorigenesis. Our aim was to obtain a comprehensive picture of these changes in colorectal adenomas. Using a 3-pronged
Localization of the human homologue of the Drosophila dachshund gene (DACH) to chromosome 13q21.
Z Kozmik and A Cvekl
Genomics, 59(1), 110-111 (1999)
Marina Zimmermann et al.
JCI insight, 6(7) (2021-03-12)
Morphologic examination of tissue biopsies is essential for histopathological diagnosis. However, accurate and scalable cellular quantification in human samples remains challenging. Here, we present a deep learning-based approach for antigen-specific cellular morphometrics in human kidney biopsies, which combines indirect immunofluorescence
Nicole Endlich et al.
Journal of cellular and molecular medicine, 22(5), 2656-2669 (2018-03-03)
Dedifferentiation and loss of podocytes are the major cause of chronic kidney disease. Dach1, a transcription factor that is essential for cell fate, was found in genome-wide association studies to be associated with the glomerular filtration rate. We found that

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással