HPA012530

Anti-LGR5 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: LGR5 Antibody - Anti-LGR5 antibody produced in rabbit, Lgr5 Antibody, Anti-G-protein coupled receptor 49, Anti-G-protein coupled receptor 67, Anti-Leucine-rich repeat-containing G-protein coupled receptor 5 precursor, Anti-Orphan G-protein coupled receptor HG38
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA012530
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• faj reaktivitás: human
• technika/technikák: immunohistochemistry: 1:200- 1:500
• immunogén szekvencia: AIIHPNAFSTLPSLIKLDLSSNLLSSFPITGLHGLTHLKLTGNHALQSLISSENFPELKVIEMPYAYQCCAFGVCENAYKISNQWNKGDNSSMDDLHKKDAGMFQAQDERDLEDFLLDFEEDLKALHSVQCSPSPGPFKPCEHLLDG
• UniProt elérési szám: O75473
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... LGR5(8549)

Leírás

Általános leírás

Leucine-rich repeat containing G protein-coupled receptor 5 (LGR5) is a seven-transmembrane G-protein coupled receptor. It belongs to the family of glycoprotein hormone receptor family. LGR5 is present in the endometrium layer. The LGR5 gene is located on human chromosome location 12q21.1.

Immunogen

Leucine-rich repeat-containing G-protein coupled receptor 5 precursor recombinant protein epitope signature tag (PrEST)

Alkalmazás

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies^® protocols and other useful information.

Anti-LGR5 antibody produced in rabbit has been used in:

• immunocytochemistry
• immunohistochemistry
• western blotting

Biokémiai/fiziológiai hatások

Leucine-rich repeat containing G protein-coupled receptor 5 (LGR5) binds to R-spondin and enhances the Wnt/ β-catenin pathway. It stimulates tumor progression and induces colorectal cancer development. Lgr5 acts as a potential stem cell marker in numerous adult tissues. It has clinicopathological significance in various cancers, like colon, stomach, liver and esophagus. Elevated expression of LGR5 is associated with ovarian, colon and hepatocellular cancers.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST71276

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)