HPA007459
Anti-ROCK2 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-ρ Kinase 2 antibody produced in rabbit, Anti-ρ-Associated protein kinase 2 antibody produced in rabbit, Anti-ρ-Associated, coiled-coil-containing protein kinase 2 antibody produced in rabbit, Anti-p164 ROCK-2 antibody produced in rabbit
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(7)
About This Item
konjugátum:
unconjugated
application:
IHC
klón:
polyclonal
faj reaktivitás:
rat, mouse, human
citations:
13
technika/technikák:
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
immunohistochemistry: 1:500-1:1000
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
rat, mouse, human
fejlettebb validálás
independent
Learn more about Antibody Enhanced Validation
technika/technikák
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
immunogén szekvencia
FVGNQLPFIGFTYYRENLLLSDSPSCRETDSIQSRKNEESQEIQKKLYTLEEHLSNEMQAKEELEQKCKSVNTRLEKTAKELEEEITLRKSVESALRQLEREKALLQHKNAEYQRKADHEADK
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... ROCK2(9475)
Általános leírás
ROCK (Rho-associated, coiled-coil containing protein kinase) has two isoforms, ROCK1 and ROCK2 that share 65% sequence similarity. ROCK has three domains that include the N-terminal catalytic domain (CAT), a middle coiled-coil domain that mediates homodimerization, and Rho-binding (RB) and pleckstrin homology (PH) domains (RB/PH domain) at the C-terminus. The RB/PH domain acts as an autoinhibitory domain and suppresses the kinase activity of CAT.
Immunogén
ρ-Associated protein kinase 2 recombinant protein epitope signature tag (PrEST)
Alkalmazás
Anti-ROCK2 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biokémiai/fiziológiai hatások
ROCK2 (Rho-associated, coiled-coil containing protein kinase 2) gene encodes a serine/threonine kinase that serves as an effector for the small GTPase RhoA. ROCK2 is localized to the nucleus and is capable of associating with and phosphorylating p300, thereby increasing the acetyltransferase activity of p300. ROCK functions in several cellular activities, such as regulation of actin cytoskeleton and cell polarity, cell adhesion, cytokinesis, and gene expression. It inhibits keratinocyte terminal differentiation. In ROCK2, the RB/PH domain is cleaved by granzyme B to generate an active form that is involved in the generation of cytoplasmic apoptotic bleb. It interacts with nucleophosmin/B23 and initiates centrosome duplication.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST71422
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Stoyan Popkirov et al.
Acta neuropathologica communications, 5(1), 40-40 (2017-05-31)
Onconeural antibodies are associated with cancer and paraneoplastic encephalitis. While their pathogenic role is still largely unknown, their high diagnostic value is undisputed. In this study we describe the discovery of a novel target of autoimmunity in an index case
Jonathan M Weiss et al.
Science signaling, 9(437), ra73-ra73 (2016-07-21)
Rho-associated kinase 2 (ROCK2) determines the balance between human T helper 17 (TH17) cells and regulatory T (Treg) cells. We investigated its role in the generation of T follicular helper (TFH) cells, which help to generate antibody-producing B cells under
Benedek Bozóky et al.
International journal of cancer, 133(2), 286-293 (2013-01-16)
Increasing evidence indicates the importance of the tumor microenvironment, in particular cancer-associated fibroblasts, in cancer development and progression. In our study, we developed a novel, visually based method to identify new immunohistochemical signatures of these fibroblasts. The method employed a
Zijian Wang et al.
Aging and disease (2024-06-25)
Tauopathies, a group of neurodegenerative disorders, are characterized by disrupted homeostasis of the microtubule binding protein tau. Nogo-A mainly hinders axonal growth and development in neurons, but the underlying mechanism of tau vulnerability has not been determined. Here, to gain
Michael Sebbagh et al.
The Journal of experimental medicine, 201(3), 465-471 (2005-02-09)
Caspase activation in target cells is a major function of granzyme B (grB) during cytotoxic lymphocyte granule-induced apoptosis. grB-mediated cell death can occur in the absence of active caspases, and the molecular targets responsible for this additional pathway remain poorly
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással