HPA006539

Anti-SLC2A3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-GLUT3, Anti-GTR3, Anti-Glucose transporter type 3, brain, Anti-Solute carrier family 2, facilitated glucose transporter member 3
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA006539
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; IHC
• klón: polyclonal
• faj reaktivitás: human
• citations: 12
• technika/technikák: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• Forma: buffered aqueous glycerol solution
• faj reaktivitás: human
• technika/technikák: immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:200-1:500
• immunogén szekvencia: KVPETRGRTFEDITRAFEGQAHGADRSGKDGVMEMNSIEPAKETTT
• UniProt elérési szám: P11169
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... SLC2A3(6515)

Leírás

Immunogén

Solute carrier family 2, facilitated glucose transporter member 3 recombinant protein epitope signature tag (PrEST)

Alkalmazás

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Biokémiai/fiziológiai hatások

SLC2A3 (solute carrier family 2) encodes a high-affinity glucose transporter protein. It is widely expressed in various tissues specifically chondrocytes. It is involved in the immune response and chondrocyte metabolism. During embryonic development, it helps to transport glucose from maternal blood across the placental trophoblastic tissue for the fetal growth. In rheumatoid arthritis (RA), it plays a vital role in the immune response and chondrocyte function. In addition to RA, it is also associated with various diseases, including dyslexia, Alzheimer′s disease, schizophrenia, and Huntingtons disease. It has also been reported that GLUT3 gene may have clinical importance in the myelomeningocele (MM) disease.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST70035

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)