Összes fotó(8)
Fontos dokumentumok
HPA003324
Anti-SLC16A1 antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-MCT 1, Anti-Monocarboxylate transporter 1, Anti-Solute carrier family 16 member 1
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(8)
About This Item
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
human
fejlettebb validálás
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technika/technikák
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
immunogén szekvencia
PTKAGKDKSKASLEKAGKSGVKKDLHDANTDLIGRHPKQEKRSVFQTINQFLDLTLFTHRGF
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... SLC16A1(6566)
Általános leírás
Solute carrier family 16, member 1 (SLC16A1) gene spanning 44kb is mapped to human chromosome 1p13.2-p12. The encoded protein MCT1, belongs to the monocarboxylate transporter (MCT) family.
Immunogén
Monocarboxylate transporter 1 recombinant protein epitope signature tag (PrEST)
Alkalmazás
Anti-SLC16A1 antibody produced in rabbit has been used in immunostaining and immunoblotting.
Anti-SLC16A1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biokémiai/fiziológiai hatások
Solute carrier family 16, member 1(SLC16A1) gene encodes a proton-coupled monocarboxylate transporter that catalyzes the transport of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids, acetoacetate, β-hydroxybutyrate and acetate.The protein is essential for normal assimilation of nutrients. It is coexpressed with lactate dehydrogenase B (LDHB) in basal-like breast cancer. It is found to be expressed on tumor cells. It serves as a potential therapeutic target for high-risk neuroblastomas. Mutation in SLC16A1 causes profound ketoacidosis characterized with imbalanced hepatic production and extrahepatic utilization of ketone bodies.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST86072
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Válasszon a legfrissebb verziók közül:
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Boglarka Zambo et al.
Science advances, 8(51), eade3828-eade3828 (2022-12-22)
Characterizing macromolecular interactions is essential for understanding cellular processes, yet most methods currently used to detect protein interactions from cells are qualitative. Here, we introduce the native holdup (nHU) approach to estimate equilibrium binding constants of protein interactions directly from
Peter M van Hasselt et al.
The New England journal of medicine, 371(20), 1900-1907 (2014-11-13)
Ketoacidosis is a potentially lethal condition caused by the imbalance between hepatic production and extrahepatic utilization of ketone bodies. We performed exome sequencing in a patient with recurrent, severe ketoacidosis and identified a homozygous frameshift mutation in the gene encoding
Genetic variations in the MCT1 (SLC16A1) gene in the Chinese population of Singapore
Lean CB and Lee EJD
Drug Metabolism and Pharmacokinetics, 24(5), 469-474 (2009)
Jun Fang et al.
Molecular pharmacology, 70(6), 2108-2115 (2006-09-27)
Neuroblastomas produce high amounts of lactic acid and upregulate the H(+)-linked monocarboxylate transporter isoform 1 (MCT1/SLC16A1). We found elevated MCT1 mRNA levels in fresh neuroblastoma biopsy samples that correlated positively with risk of fatal disease and amplification of the "proto-oncogenic"
MDA-MB-231 breast cancer cells fuel osteoclast metabolism and activity: A new rationale for the pathogenesis of osteolytic bone metastases
Lemma S, et al.
Biochimica et Biophysica Acta (BBA)-Molecular Basis of Disease, 1863(12), 3254-3264 (2017)
Cikkek
Protein-based drug transporters are expressed in Sf9 cells. Understanding the specific mechanisms of tumor cell transporters is an essential aspect of chemotherapeutic drug design.
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással