AV34909

Anti-CHRNA1 (AB1) antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-Cholinergic receptor, nicotinic, α-1 (muscle)
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 52 kDa
• faj reaktivitás: human
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• NCBI elérési szám: NP_000070
• UniProt elérési szám: P02708-2
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CHRNA1(1134)

Leírás

Általános leírás

CHRNA1 encodes the α subunit of the muscle acetylcholine receptor and is involved in acetyl choline binding and channel gating functions. The expression of CHRNA1 in thymus tissues is controlled by IRF8 and AIRE.
Rabbit Anti-CHRNA1 recognizes mouse, bovine, canine, and human CHRNA1.

Immunogen

Synthetic peptide directed towards the N terminal region of human CHRNA1

Alkalmazás

Rabbit Anti-CHRNA1 is suitable for western blot applications at a concentration of 1.8 μg/ml.

Biokémiai/fiziológiai hatások

The muscle acetylcholine receptor consiststs of 5 subunits of 4 different types: 2 alpha isoforms and 1 each of beta, gamma, and delta subunits.2 CHRNA1 encodes an alpha subunit that plays a role in acetlycholine binding/channel gating.

Szekvencia

Synthetic peptide located within the following region: TRLVAKLFKDYSSVVRPVEDHRQVVEVTVGLQLIQLINVDEVNQIVTTNV

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 2
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable