![[Leu15]-Gastrin I human ≥95% (HPLC)](/deepweb/assets/sigmaaldrich/product/structures/153/342/d4cb3dd7-13f1-46cf-8d1f-3907a5de7a83/640/d4cb3dd7-13f1-46cf-8d1f-3907a5de7a83.png)
The concentration of this product is determined by Bradford Assay. Please see the link below to review a sample Certificate of Analysis:
https://www.sigmaaldrich.com/certificates/sapfs/PROD/sap/certificate_pdfs/COFA/Q14/N17001-20UG-PW057M4890V.pdf
N17001
Noggin human
recombinant, expressed in HEK 293 cells, suitable for cell culture
Sinônimo(s):
Noggin human
Faça loginpara ver os preços organizacionais e de contrato
Selecione um tamanho
20 μG
R$ 2.168,00
Selecione um tamanho
Alterar visualização
20 μG
R$ 2.168,00
About This Item
Produtos recomendados
recombinante
expressed in HEK 293 cells
Nível de qualidade
Ensaio
≥98% (SDS-PAGE)
Formulário
lyophilized powder
potência
≤10 ng/mL ED50
peso molecular
23 kDa (The protein migrates as a 25 kDa band on SDS-PAGE due to glycosylation)
técnica(s)
cell culture | mammalian: suitable
temperatura de armazenamento
−20°C
Procurando produtos similares? Visita Guia de comparação de produtos
Descrição geral
Recombinant human Noggin is expressed in human 293 cells as a glycoprotein with a calculated molecular mass of 23 kDa. This protein is manufactured in human cells using an all-human production system, with no serum. The human cells expression system allows human-like glycosylation and folding, and often supports better stability of the protein in culture.
Ações bioquímicas/fisiológicas
Noggin is a secreted protein that inhibits the binding of bone morphogenetic proteins (BMPs) to their cognate receptor. It is a 232 amino acid-secreted glycosylated protein, which forms covalently linked homodimers and has high affinity for BMP4.[1] hESC cultured with noggin (in medium or incorporated into extracellular matrix) form denser colonies compared to normal hESC cultures, suggesting that the presence of noggin promotes better growth. Noggin can be incorporated as a medium supplement for maintaining stem cells in a pluripotent state, for short-term culture experiments. Noggin does not trigger differentiation towards a neuronal lineage. Furthermore, when incorporated into extracellular matrix, noggin prevented spontaneous differentiation during the time period examined. In a surgically induced knee osteoarthritis model in mice, expression of noggin mRNA was lost from the articular cartilage, which correlated with loss of BMP2/4 and pSMAD1/5/8, an indicator of active BMP signaling.
Sequência
QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
forma física
Supplied as a lyophilized powder containing phosphate buffered saline.
Nota de análise
The biological activity of recombinant human noggin was tested in culture by measuring its ability to inhibit BMP4-induced alkaline phosphatase production by ATDC5 cells (human erythroleukemic indicator cell line).
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.
The EC50 is defined as the effective concentration of growth factor that elicits a 50% decrease in alkaline phosphatase secretion in a cell based bioassay.
Código de classe de armazenamento
11 - Combustible Solids
Classe de risco de água (WGK)
WGK 2
Ponto de fulgor (°F)
Not applicable
Ponto de fulgor (°C)
Not applicable
Escolha uma das versões mais recentes:
Certificados de análise (COA)
Lot/Batch Number
Não está vendo a versão correta?
Se precisar de uma versão específica, você pode procurar um certificado específico pelo número do lote ou da remessa.
Já possui este produto?
Encontre a documentação dos produtos que você adquiriu recentemente na biblioteca de documentos.
Os clientes também visualizaram
The expression patterns of gremlin 1 and noggin in normal adult and tumor tissues.
Laurilla R, et al.
International Journal of Clinical and Experimental Pathology, 6(7), 1400-1408 (2013)
Wenjing Xiao et al.
Autophagy, 18(11), 2615-2635 (2022-03-08)
Macroautophagy/autophagy is a conserved cellular process associated with tumorigenesis and aggressiveness, while mechanisms regulating expression of autophagic machinery genes in cancers still remain elusive. Herein, we identified E2F4 (E2F transcription factor 4) as a novel transcriptional activator of cytoprotective autophagy
Artigos
Role of growth factors in stem cell differentiation and various growth factors for your research at sigmaaldrich.com
-
Buongiorno, che test utilizzate per determinare la concentrazione di noggin? grazie
1 answer-
Helpful?
-
Active Filters
Nossa equipe de cientistas tem experiência em todas as áreas de pesquisa, incluindo Life Sciences, ciência de materiais, síntese química, cromatografia, química analítica e muitas outras.
Entre em contato com a assistência técnica
