WH0004869M1

Monoclonal Anti-NPM1 antibody produced in mouse

clone 3B2, purified immunoglobulin, buffered aqueous solution

• Synonim(y): Anti-B23, Anti-NPM, Anti-nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• Numer MDL: MFCD03455664
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 3B2, monoclonal
• Postać: buffered aqueous solution
• reaktywność gatunkowa: human
• metody: ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• izotyp: IgG1κ
• numer dostępu GenBank: BC002398
• numer dostępu UniProt: P06748
• Zastosowanie: research pathology
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... NPM1(4869)

Opis

Opis ogólny

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]). This gene is located on human chromosome 5q35.

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.

Immunogen

NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Zastosowanie

Monoclonal Anti-NPM1 antibody produced in mouse has been used in immunoblotting.

The antibody may be used for ELISA, competitive ELISA, immunoblotting (37 kDa), immunoprecipitation, immunohistochemistry, immunocytochemistry (2% formaldehyde-acetone 1,2,5 or 10% formalin/methanol-1% NP-40 and microinjection (blocks the initiation of centrosome duplication). Reactivity has been observed with human, monkey, bovine, dog, hamster (weak), rat,kangaroo rat, and mouse B23.

Działania biochem./fizjol.

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells.

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells. Mutations in NPM1 result in acute myeloid leukemia (AML).

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Informacje prawne

GenBank is a registered trademark of United States Department of Health and Human Services

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable
• Środki ochrony indywidualnej: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)