SAB2108453

Anti-TFEB

affinity isolated antibody

• Synonim(y): Anti-Math5
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Formularz: buffered aqueous solution
• masa cząsteczkowa: 53 kDa
• reaktywność gatunkowa: horse, human, rabbit, pig, mouse, goat, bovine, rat
• stężenie: 0.5-1 mg/mL
• metody: immunoblotting: suitable
• numer dostępu UniProt: P19484
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... TFEB(7942)

Opis

Opis ogólny

Transcription factor EB (TFEB) is encoded by the gene mapped to human chromosome 6p21.1. The encoded protein belongs to the MiT transcription factor family. TFEB is widely expressed and is characterized with a transactivation domain, basic-helix-loop-helix domain, glutamine rich region, leucine zipper region and proline rich region.

Immunogen

Synthetic peptide directed towards the middle region of human TFEB

Działania biochem./fizjol.

Transcription factor EB (TFEB) plays a key role in the regulation of autophagy and lysosome biogenesis. TFEB, expressed in endothelial cells, reduces inflammation and hinders atherosclerosis development. Thus, this protein can be considered as a potent therapeutic target for atherosclerosis and associated cardiovascular diseases.

Sekwencja

Synthetic peptide located within the following region: IKELGMLIPKANDLDVRWNKGTILKASVDYIRRMQKDLQKSRELENHSRR

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Ta strona może zawierać tekst przetłumaczony maszynowo.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable