This product has not been tested for use in mouse, however, it is unlikely to react. The supplier, Atlas Antibodies, notes that the sequence homology with the mouse (ENSMUSG00000035158) is 88% and rat (ENSRNOG00000008658) is 87%.
HPA003259
Anti-MITF antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
MI, Microphthalmia-associated transcription factor, WS2, WS2A, bHLHe32
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wybierz wielkość
100 μL
2440,00 zł
2440,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Wybierz wielkość
Zmień widok
100 μL
2440,00 zł
About This Item
2440,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Polecane produkty
pochodzenie biologiczne
rabbit
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Formularz
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
recombinant expression
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000
sekwencja immunogenna
HLLLRIQELEMQARAHGLSLIPSTGLCSPDLVNRIIKQEPVLENCSQDLLQHHADLTCTTTLDLTDGTITFNNNLGTGTEANQAYSVPTKMGSKLEDILMDDTLSPVGVTDPLLSSVSPGASKTSSRRSSMSMEETEHT
numer dostępu UniProt
Zastosowanie
research pathology
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... MITF(4286)
Opis ogólny
MITF (microphthalmia-associated transcription factor) is a basic helix-loop-helix, leucine-zipper transcription factor. It is located on human chromosome 3p13.
Microphthalmia-associated transcription factor (MITF) is a bHLH-ZIP transcription factor that recognizes E-box (CAYRTG) and M-box (TCAYRTG or CAYRTGA) sequences in the promoter regions of target genes. Microphthalmia-associated transcription factor (MITF) is a master regulator in melanocyte proliferation, development, survival and melanoma formation and an essential regulator of osteoclastogenesis.
Rabbit polyclonal anti-MITF antibody recognizes human microphthalmia-associated transcription factor.
Immunogen
Microphthalmia-associated transcription factor recombinant protein epitope signature tag (PrEST)
Zastosowanie
Anti-MITF antibody has been used in immunohistochemistry and chromatin immunoprecipitation.
Rabbit polyclonal anti-MITF antibody is used to tag microphthalmia-associated transcription factor for detection and quantitation by immunocytochemical and immunohistochemical (IHC) techniques. It is used as a probe to determine the presence and roles of microphthalmia-associated transcription factor in melanocyte proliferation, development, and survival and the regulation of regulator of osteoclastogenesis.
Działania biochem./fizjol.
MITF (microphthalmia-associated transcription factor) participates in the growth and differentiation of melanocytes. Mutations in MITF results in waardenburg syndrome type IIa.
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST84788
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Melanocyte development in the mouse tail epidermis requires the Adamts9 metalloproteinase
Tharmarajah G, et al.
Pigment Cell & Melanoma Research (2018)
Non-clear cell renal cell carcinomas: biological insights and therapeutic challenges and opportunities
Malouf G G, et al.
Clinical Advances in Hematology & Oncology : H&O, 15(6), 409-418 (2017)
Stefanie Riesenberg et al.
Nature communications, 6, 8755-8755 (2015-11-05)
Inflammation promotes phenotypic plasticity in melanoma, a source of non-genetic heterogeneity, but the molecular framework is poorly understood. Here we use functional genomic approaches and identify a reciprocal antagonism between the melanocyte lineage transcription factor MITF and c-Jun, which interconnects
Human melanocytes mitigate keratinocyte-dependent contraction in an in vitro collagen contraction assay
Rakar J, et al.
Burns : Journal of the International Society For Burn Injuries, 41(5), 1035-1042 (2015)
The MITF, p. E318K Variant, as a Risk Factor for Pheochromocytoma and Paraganglioma.
Castro-Vega L J, et al.
The Journal of clinical endocrinology and metabolism, 101(12), 4764-4768 (2016)
-
Does it detect mouse MITF too ?
1 answer-
Helpful?
-
Active Filters
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej
