SAB2107648

Anti-DNASE1L3 antibody produced in rabbit

affinity isolated antibody

• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: rabbit
• Poziom jakości: 100
• białko sprzężone: unconjugated
• forma przeciwciała: affinity isolated antibody
• rodzaj przeciwciała: primary antibodies
• klon: polyclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: 34 kDa
• reaktywność gatunkowa: human
• stężenie: 0.5 mg - 1 mg/mL
• metody: western blot: suitable
• numer dostępu NCBI: NM_004944
• numer dostępu UniProt: Q13609
• Warunki transportu: wet ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... DNASE1L3(1776)

Opis

Opis ogólny

DNASE1L3 (Deoxyribonuclease I-like 3) is a 32kDa endonuclease protein expressed in the spleen, liver, thymus, lymph node, bone marrow, small intestine and kidney. It consists of an N-terminal signal peptide responsible for the rER (rough endoplasmic reticulum) transport.

Immunogen

The immunogen for anti-DNASE1L3 antibody: synthetic peptide derected towards the C terminal of human DNASE1L3

Zastosowanie

Anti-DNASE1L3 antibody produced in rabbit is suitable for western blot and indirect ELISA.

Działania biochem./fizjol.

DNASE1L3 (Deoxyribonuclease I-like 3) is involved in residual nuclease activity of internucleosomal chromatin. In presence of Ca²⁺/Mg²⁺, it produces 3′-OH/5′-P ends by cleaving both the DNA strand, double-stranded and single-stranded DNA molecule. It has also been reported that DNASE1L3 may cleave apoptotic DNA of thymocytes, neuronal PC12 cells, C2C12 myoblasts and of cell lines expressing the recombinant nuclease. Mutation in DNASE1L3 causes a rare syndrome, hypocomplementemic urticarial vasculitis syndrome (HUVS).

Sekwencja

Synthetic peptide located within the following region: DFQKAYKLTEEEALDVSDHFPVEFKLQSSRAFTNSKKSVTLRKKTKSKRS

Postać fizyczna

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 3
• Temperatura zapłonu (°F): Not applicable
• Temperatura zapłonu (°C): Not applicable