Przejdź do zawartości
Merck
Wszystkie zdjęcia(2)

Kluczowe dokumenty

HPA004940

Sigma-Aldrich

Anti-AATF antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-BFR2, Anti-CHE-1, Anti-CHE1, Anti-DED

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.43
białko sprzężone:
unconjugated
application:
IHC
klon:
polyclonal
reaktywność gatunkowa:
human
citations:
6
metody:
immunohistochemistry: 1:50- 1:200

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Formularz

buffered aqueous glycerol solution

reaktywność gatunkowa

human

metody

immunohistochemistry: 1:50- 1:200

sekwencja immunogenna

SVQSISDFEKFTKGMDDLGSSEEEEDEESGMEEGDDAEDSQGESEEDRAGDRNSEDDGVVMTFSSVKVSEEVEKGRAVKNQIALWDQLLEGRIKLQKALLTTNQLPQPDVFPLFKDKGGPEFSSALKNSHKALKALLTSLVGLQ

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... AATF(26574)

Opis ogólny

Apoptosis antagonizing transcription factor (AATF) is a 73kDa nuclear phosphoprotein, which is made of 523 amino acids. Human AATF consists of a leucine zipper, many phosphorylation sites, putative nuclear localization signal- NLS1 and NLS2 and three motifs, which bind to nuclear receptors. The leucine zipper lies within residues 239- 260, and putative NLS within residues 300 and 467. AATF has an acidic N- terminal domain with two very acidic regions from residues 20-49 and 107-170, and these regions are separated by a Ser/Thr-rich domain. AATF is also known as Che-1, and in humans, it is located on chromosome 17q11.2-q12.

Immunogen

Protein AATF recombinant protein epitope signature tag (PrEST)

Zastosowanie

Anti-AATF antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Działania biochem./fizjol.

AATF was initially identified to interact with DAP like kinase (Dlk) and it interferes with Dlk- induced apoptosis. AATF has an essential role in the early steps of embryogenesis. It also interacts with transcription factors as an adaptor to promote transcription. AATF is activated by ER (endoplasmic reticulum) stress through PERK signalling, which in turn activates v-akt murine thymoma viral oncogene homolog 1 (AKT1) via STAT3, leading to cell survival and cell resistance to ER stress. AATF and Wolfram syndrome 1 (WFS1) genes have also been shown to crosstalk, and therefore deficiencies in either gene mediate apoptosis in Wolfram syndrome. AATF might also act as a neuroprotective agent as its suppression by Aβ protein in cortical neuronal cells increases Aβ toxicity in these cells. AATF also interacts with Par-4 (prostate apoptosis response-4) and prevents the aberrant production of Aβ-42 peptide by Par-4.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST86928

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Wybierz jedną z najnowszych wersji:

Certyfikaty analizy (CoA)

Lot/Batch Number

Nie widzisz odpowiedniej wersji?

Jeśli potrzebujesz konkretnej wersji, możesz wyszukać konkretny certyfikat według numeru partii lub serii.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

AATF protects neural cells against oxidative damage induced by amyloid beta-peptide.
Xie J and Guo Q
Neurobiology of Disease, 16(1), 150-157 (2004)
The anti-apoptotic factor Che-1/AATF links transcriptional regulation, cell cycle control, and DNA damage response.
Passananti C and Fanciulli M
Cell Division, 2, 21-21 (2007)
G Page et al.
FEBS letters, 462(1-2), 187-191 (1999-12-02)
Dlk, also known as ZIP kinase, is a serine/threonine kinase that is tightly associated with nuclear structures. Under certain conditions, which require cytoplasmic localization, Dlk can induce apoptosis. In search for interaction partners that might serve as regulators or targets
Katja Höpker et al.
The EMBO journal, 31(20), 3961-3975 (2012-08-23)
Following genotoxic stress, cells activate a complex signalling network to arrest the cell cycle and initiate DNA repair or apoptosis. The tumour suppressor p53 lies at the heart of this DNA damage response. However, it remains incompletely understood, which signalling
Qing Guo et al.
The Journal of biological chemistry, 279(6), 4596-4603 (2003-11-25)
Aggregation of the neurotoxic amyloid beta peptide 1-42 (Abeta-(1-42)) in the brain is considered to be an early event in the pathogenesis of Alzheimer's disease (AD). Par-4 (prostate apoptosis response-4) is a leucine zipper protein that is pro-apoptotic and associated

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej