WH0004869M1

Monoclonal Anti-NPM1 antibody produced in mouse

clone 3B2, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-B23, Anti-NPM, Anti-nucleophosmin (nucleolar phosphoprotein B23, numatrin)
• MDL-szám: MFCD03455664
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 3B2, monoclonal
• form: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: ELISA: suitable; immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• GenBank elérési szám: BC002398
• UniProt elérési szám: P06748
• alkalmazás(ok): research pathology
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... NPM1(4869)

Leírás

Általános leírás

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]). This gene is located on human chromosome 5q35.

NPM1 is a ubiquitously expressed nucleolar protein that shuttles between the nucleus and cytoplasm. It is implicated in multiple functions, including ribosomal protein assembly and transport, control of centrosome duplication, and regulation of the tumor suppressor ARF (MIM 600160). NPM1 mutations that relocalize NPM1 from the nucleus into the cytoplasm are associated with development of acute myeloid leukemia (AML; MIM 601626) (Garzon et al., 2008 [PubMed 18308931]).[supplied by OMIM]
Nucleophosmin 1 (NPM1) is an important multifunctional protein mainly located in the nucleolus. This gene is located on human chromosome 5q35.

Immunogen

NPM1 (AAH02398.1, 1 a.a. ~ 294 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MEDSMDMDMSPLRPQNYLFGCELKADKDYHFKVDNDENEHQLSLRTVSLGAGAKDELHIVEAEAMNYEGSPIKVTLATLKMSVQPTVSLGGFEITPPVVLRLKCGSGPVHISGQHLVAVEEDAESEDEEEEDVKLLSISGKRSAPGGGSKVPQKKVKLAADEDDDDDDEEDDDEDDDDDDFDDEEAEEKAPVKKSIRDTPAKNAQKSNQNGKDSKPSSTPRSKGQESFKKQEKTPKTPKGPSSVEDIKAKMQASIEKGGSLPKVEAKFINYVKNCFRMTDQEAIQDLWQWRKSL

Alkalmazás

Monoclonal Anti-NPM1 antibody produced in mouse has been used in immunoblotting.

The antibody may be used for ELISA, competitive ELISA, immunoblotting (37 kDa), immunoprecipitation, immunohistochemistry, immunocytochemistry (2% formaldehyde-acetone 1,2,5 or 10% formalin/methanol-1% NP-40 and microinjection (blocks the initiation of centrosome duplication). Reactivity has been observed with human, monkey, bovine, dog, hamster (weak), rat,kangaroo rat, and mouse B23.

Biokémiai/fiziológiai hatások

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells.

NPM1 (nucleophosmin 1) induces cell proliferation. It increases migration and invasion of cells. Mutations in NPM1 result in acute myeloid leukemia (AML).

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)