WH0002984M1

Monoclonal Anti-GUCY2C antibody produced in mouse

clone 2F3, purified immunoglobulin, buffered aqueous solution

• Szinonimák: Anti-GUC2C, Anti-STAR, Anti-guanylate cyclase 2C (heat stable enterotoxin receptor)
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); WB
• klón: 2F3, monoclonal
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 2F3, monoclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG2bκ
• GenBank elérési szám: NM_004963.3
• UniProt elérési szám: P25092
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... GUCY2C(2984)

Leírás

Immunogén

GUCY2C (NP_004954, 24 a.a. ~ 133 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SQVSQNCHNGSYEISVLMMGNSAFAEPLKNLEDAVNEGLEIVRGRLQNAGLNVTVNATFMYSDGLIHNSGDCRSSTCEGLDLLRKISNAQRMGCVLIGPSCTYSTFQMYL

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi információk

GenBank is a registered trademark of United States Department of Health and Human Services

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)