SAB5702248

Anti-Folate Binding Protein(FBP) / FOLR1 Antibody, clone 3J6W3, Rabbit Monoclonal

• Szinonimák: FOLR1,FBP,FOLR
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• material: colorless
• klón: 3J6W3, monoclonal
• form: liquid
• molekulatömeg: 38 kDa
• faj reaktivitás: human, rat, rat
• koncentráció: 0.93 mg/mL
• technika/technikák: western blot: 1:500 - 1:1000
• szín: colorless
• izotípus: IgG
• immunogén szekvencia: MAQRMTTQLLLLLVWVAVVGEAQTRIAWARTELLNVCMNAKHHKEKPGPEDKLHEQCRPWRKNACCSTNTSQEAHKDVSYLYRFNWNHCGEMAPACKRHF
• UniProt elérési szám: P15328
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... FOLR1(2348)

Leírás

Általános leírás

The protein encoded by this gene is a member of the folate receptor family. Members of this gene family bind folic acid and its reduced derivatives, and transport 5-methyltetrahydrofolate into cells. This gene product is a secreted protein that either anchors to membranes via a glycosyl-phosphatidylinositol linkage or exists in a soluble form. Mutations in this gene have been associated with neurodegeneration due to cerebral folate transport deficiency. Due to the presence of two promoters, multiple transcription start sites, and alternative splicing, multiple transcript variants encoding the same protein have been found for this gene.

Immunogen

A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Folate Binding Protein(FBP) / FOLR1 (NP_000793.1).

PBS with 0.05% proclin300,0.05% BSA,50% glycerol,pH7.3.

Alkalmazás

WB

Biztonsági adatok

• Piktogramok: GHS07,GHS09
• Figyelmeztetés: Warning
• Figyelmeztető mondatok: H317,H411
• Óvintézkedésre vonatkozó mondatok: P261 - P272 - P273 - P280 - P302 + P352 - P333 + P313
• Veszélyességi osztályok: Aquatic Chronic 2 - Skin Sens. 1
• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3