SAB2108851

Anti-NOX5 (C-terminal) antibody produced in rabbit biotin conjugated

affinity isolated antibody

• UNSPSC kód: 12352203
• NACRES: NA.45
• konjugátum: biotin conjugate
• klón: polyclonal

Tulajdonságok

• biológiai forrás: rabbit
• konjugátum: biotin conjugate
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• molekulatömeg: 62 kDa
• faj reaktivitás (homológia által előrejelzett): rabbit, bovine, pig, human
• koncentráció: 0.5 mg/mL
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... NOX5(79400)

Leírás

Általános leírás

This gene is predominantly expressed in the testis and lymphocyte-rich areas of spleen and lymph nodes. It encodes a calcium-dependen NADPH oxidase that generates superoxide, and functions as a calcium-dependent proton channel that may regulate redox-dependent processes in lymphocytes and spermatozoa. Alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Immunogén

Synthetic peptide directed towards the C-terminal region of Human NOX5

Szekvencia

Synthetic peptide located within the following region: DQAEEAQYGRFLELHMYMTSALGKNDMKAIGLQMALDLLANKEKKDSITG

Fizikai forma

Supplied at 0.5 mg/ml in phosphate-buffered saline, 0.09% sodium azide

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: nwg
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable