SAB2100491

Anti-CSNK1A1 antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-CK1, Anti-Casein kinase 1, α1, Anti-HLCDGP1, Anti-PRO2975
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 37 kDa
• faj reaktivitás: dog, horse, human, mouse, guinea pig, rat
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: western blot: suitable
• UniProt elérési szám: P48729
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... CSNK1A1(1452)

Leírás

Immunogen

Synthetic peptide directed towards the C terminal region of human CSNK1A1

Biokémiai/fiziológiai hatások

CSNK1A1 belongs to the protein kinase superfamily. The function of the CSNK1A1 protein is not known.

Szekvencia

Synthetic peptide located within the following region: HQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTPTGKQTDKTKSNMKGF

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable