SAB1410970

Anti-PLA2G1B antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Szinonimák: MGC119834, MGC119835, PLA2, PLA2A, PPLA2
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: antigen 16.4 kDa
• faj reaktivitás: human
• technika/technikák: western blot: 1 μg/mL
• NCBI elérési szám: NM_000928.2
• UniProt elérési szám: P04054
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... PLA2G1B(5319)

Leírás

Általános leírás

Phospholipase A2 (EC 3.1.1.4) catalyzes the release of fatty acids from glycero-3-phosphocholines. The best known varieties are the digestive enzymes secreted as zymogens by the pancreas of mammals. Sequences of pancreatic PLA2 enzymes from a variety of mammals have been reported. One striking feature of these enzymes is their close homology to venom phospholipases of snakes. Other forms of PLA2 have been isolated from brain, liver, lung, spleen, intestine, macrophages, leukocytes, erythrocytes, inflammatory exudates, chondrocytes, and platelets (Seilhamer et al., 1986 [PubMed 3028739]) .[supplied by OMIM

Immunogen

PLA2G1B (NP_000919.1, 1 a.a. ~ 148 a.a) full-length human protein.

Sequence
MKLLVLAVLLTVAAADSGISPRAVWQFRKMIKCVIPGSDPFLEYNNYGCYCGLGGSGTPVDELDKCCQTHDNCYDQAKKLDSCKFLLDNPYTHTYSYSCSGSAITCSSKNKECEAFICNCDRNAAICFSKAPYNKAHKNLDTKKYCQS

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable