SAB1403535

Monoclonal Anti-AHR antibody produced in mouse

clone 4G7, purified immunoglobulin, buffered aqueous solution

• Szinonimák: bHLHe76
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); IF; WB
• klón: 4G7, monoclonal
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 4G7, monoclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~37.11 kDa
• faj reaktivitás: human
• technika/technikák: indirect ELISA: suitable; indirect immunofluorescence: suitable; western blot: 1-5 μg/mL
• izotípus: IgG
• NCBI elérési szám: NM_001621
• UniProt elérési szám: P35869
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... AHR(196)

Leírás

Általános leírás

This gene encodes a ligand-activated transcription factor involved in the regulation of biological responses to planar aromatic hydrocarbons. This receptor has been shown to regulate xenobiotic-metabolizing enzymes such as cytochrome P450. Its ligands included a variety of aromatic hydrocarbons. (provided by RefSeq)

Immunogén

AHR (NP_001612, 721 a.a. ~ 820 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
MGSFEPSPYPTTSSLEDFVTCLQLPENQKHGLNPQSAIITPQTCYAGAVSMYQCQPEPQHTHVGQMQYNPVLPGQQAFLNKFQNGVLNETYPAELNNINN

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable