SAB1402216

Monoclonal Anti-GSTM2 antibody produced in mouse

clone 1E10, purified immunoglobulin, buffered aqueous solution

• Szinonimák: GST4, GSTM, GSTM2-2, GTHMUS, MGC117303
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: ELISA (i); IF; IHC (p); WB
• klón: 1E10, monoclonal
• faj reaktivitás: mouse, human
• citations: 2
• technika/technikák: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL

Tulajdonságok

• biológiai forrás: mouse
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: 1E10, monoclonal
• Forma: buffered aqueous solution
• molekulatömeg: antigen ~37.11 kDa
• faj reaktivitás: mouse, human
• technika/technikák: immunofluorescence: suitable; immunohistochemistry (formalin-fixed, paraffin-embedded sections): suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotípus: IgG1κ
• NCBI elérési szám: NM_000848
• UniProt elérési szám: P28161
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... GSTM2(2946)

Leírás

Általános leírás

Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. At present, eight distinct classes of the soluble cytoplasmic mammalian glutathione S-transferases have been identified: alpha, kappa, mu, omega, pi, sigma, theta and zeta. This gene encodes a glutathione S-transferase that belongs to the mu class. The mu class of enzymes functions in the detoxification of electrophilic compounds, including carcinogens, therapeutic drugs, environmental toxins and products of oxidative stress, by conjugation with glutathione. The genes encoding the mu class of enzymes are organized in a gene cluster on chromosome 1p13.3 and are known to be highly polymorphic. These genetic variations can change an individual′s susceptibility to carcinogens and toxins as well as affect the toxicity and efficacy of certain drugs. (provided by RefSeq)

Immunogén

GSTM2 (NP_000839, 90 a.a. ~ 189 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
SEKEQIREDILENQFMDSRMQLAKLCYDPDFEKLKPEYLQALPEMLKLYSQFLGKQPWFLGDKITFVDFIAYDVLERNQVFEPSCLDAFPNLKDFISRFE

Biokémiai/fiziológiai hatások

GST (glutathione-S-transferases) is importantly associated with Phase II detoxification pathway and protects from toxic damage. Change in the level of GSTM2 (glutathione S-transferase μ 2) expression, is observed in cancer types such as lung cancer and ovarian teratoma.

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable