SAB1401366

Anti-SUMO2 antibody produced in rabbit

purified immunoglobulin, buffered aqueous solution

• Szinonimák: HSMT3, MGC117191, SMT3B, SMT3H2
• MDL-szám: MFCD03455941
• UNSPSC kód: 12352203
• NACRES: NA.41
• konjugátum: unconjugated
• application: IF; WB
• klón: polyclonal
• faj reaktivitás: human
• citations: 1
• technika/technikák: immunofluorescence: suitable; western blot: 1 μg/mL

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: purified immunoglobulin
• antitest terméktípus: primary antibodies
• klón: polyclonal
• Forma: buffered aqueous solution
• faj reaktivitás: human
• technika/technikák: immunofluorescence: suitable; western blot: 1 μg/mL
• NCBI elérési szám: NM_006937.3
• UniProt elérési szám: P61956
• kiszállítva: dry ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... SUMO2(6613)

Leírás

Általános leírás

This gene encodes a protein that is a member of the SUMO (small ubiquitin-like modifier) protein family. It functions in a manner similar to ubiquitin in that it is bound to target proteins as part of a post-translational modification system. However, unlike ubiquitin which targets proteins for degradation, this protein is involved in a variety of cellular processes, such as nuclear transport, transcriptional regulation, apoptosis, and protein stability. It is not active until the last two amino acids of the carboxy-terminus have been cleaved off. Numerous pseudogenes have been reported for this gene. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. (provided by RefSeq)

Immunogén

SUMO2 (NP_008868.3, 1 a.a. ~ 95 a.a) full-length human protein.

Sequence
MADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY

Fizikai forma

Solution in phosphate buffered saline, pH 7.4

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable