HPA012867
Anti-HTR2B antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Szinonimák:
Anti-5-HT-2B, Anti-5-hydroxytryptamine receptor 2B, Anti-Serotonin receptor 2B
Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez
Összes fotó(7)
About This Item
konjugátum:
unconjugated
application:
IF
IHC
IHC
klón:
polyclonal
faj reaktivitás:
human
citations:
23
technika/technikák:
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunohistochemistry: 1:50-1:200
Javasolt termékek
biológiai forrás
rabbit
Minőségi szint
konjugátum
unconjugated
antitest forma
affinity isolated antibody
antitest terméktípus
primary antibodies
klón
polyclonal
termékcsalád
Prestige Antibodies® Powered by Atlas Antibodies
Forma
buffered aqueous glycerol solution
faj reaktivitás
human
fejlettebb validálás
orthogonal RNAseq
Learn more about Antibody Enhanced Validation
technika/technikák
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:50-1:200
immunogén szekvencia
TIHALQKKAYLVKNKPPQRLTWLTVSTVFQRDETPCSSPEKVAMLDGSRKDKALPNSGDETLMRRTSTIGKKSVQTISNEQRASKVL
UniProt elérési szám
kiszállítva
wet ice
tárolási hőmérséklet
−20°C
célzott transzláció utáni módosítás
unmodified
Géninformáció
human ... HTR2B(3357)
Általános leírás
5-hydroxytryptamine receptor 2B (HTR2B) is a 481 amino acid receptor which is expressed in the liver, kidney, lungs and heart. The gene encoding this protein in located on chromosome 2q36.3-2q37.1.
Immunogén
5-hydroxytryptamine receptor 2B recombinant protein epitope signature tag (PrEST)
Alkalmazás
Anti-HTR2B antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Biokémiai/fiziológiai hatások
HTR2B (5-hydroxytryptamine receptor 2B) is G-protein coupled receptor for 5-hydroxytryptamine (serotonin). An increased expression of this receptor is seen in idiopathic pulmonary fibrosis. The activated HTR2B regulates intracellular calcium levels and affects the activity of phosphatidylinositol 3-kinase. The pathway also involved in the activation of ryanodine receptors. It has been shown that HTR2B takes part in brain development and contributes to the brain architecture.
Tulajdonságok és előnyök
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Kapcsolódás
Corresponding Antigen APREST72721
Fizikai forma
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Jogi információk
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Jogi nyilatkozat
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Nem találja a megfelelő terméket?
Próbálja ki a Termékválasztó eszköz. eszközt
Tárolási osztály kódja
10 - Combustible liquids
WGK
WGK 1
Lobbanási pont (F)
Not applicable
Lobbanási pont (C)
Not applicable
Egyéni védőeszköz
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Válasszon a legfrissebb verziók közül:
Analitikai tanúsítványok (COA)
Lot/Batch Number
Nem találja a megfelelő verziót?
Ha egy adott verzióra van szüksége, a tétel- vagy cikkszám alapján rákereshet egy adott tanúsítványra.
Már rendelkezik ezzel a termékkel?
Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.
Gaëtan Le-Bel et al.
Experimental eye research, 184, 72-77 (2019-04-20)
Uveal melanoma (UM), although a very rare disease, remains a particularly aggressive type of cancer as near 50% of the UM presenting patients will also develop liver metastases within 15 years from the initial diagnostic. One of the most reliable
T T Vellinga et al.
Oncogene, 35(40), 5263-5271 (2016-03-22)
Gene expression-based classification systems have identified an aggressive colon cancer subtype with mesenchymal features, possibly reflecting epithelial-to-mesenchymal transition (EMT) of tumor cells. However, stromal fibroblasts contribute extensively to the mesenchymal phenotype of aggressive colon tumors, challenging the notion of tumor
Zhicheng Lin et al.
Pharmacogenetics, 14(12), 805-811 (2004-12-21)
5-Hydroxytryptamine (serotonin) receptor 2B (HTR2B) is involved in brain development. Although expressed in the human brain, HTR2B has not been investigated much for its role in higher brain functions. Here we describe a genome-scan with 391 simple sequence repeat markers
Ji Won Park et al.
British journal of cancer, 123(4), 610-618 (2020-06-04)
Immunomodulatory cytokines and systemic inflammatory markers are important during cancer development and progression. This study investigated the association and prognostic impact of systemic cytokine profiles and inflammatory markers in colorectal cancer (CRC). Interleukin (IL)-1β, IL-6, IL-8, IL-9, IL-10, tumour necrosis
Melanie Königshoff et al.
Thorax, 65(11), 949-955 (2010-07-31)
Idiopathic pulmonary fibrosis (IPF) has a poor prognosis and limited responsiveness to available treatments. It is characterised by epithelial cell injury, fibroblast activation and proliferation and extracellular matrix deposition. Serotonin (5-hydroxytryptamine; 5-HT) induces fibroblast proliferation via the 5-HTR(2A) and 5-HTR(2B)
Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.
Lépjen kapcsolatba a szaktanácsadással