HPA004345

Anti-TRIM33 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Szinonimák: Anti-E3 ubiquitin-protein ligase TRIM33, Anti-Ectodermin homolog, Anti-Protein Rfg7, Anti-RET-fused gene 7 protein, Anti-TIF1-gamma, Anti-Transcription intermediary factor 1-gamma, Anti-Tripartite motif-containing protein 33
• UNSPSC kód: 12352203
• Human Protein Atlas-szám: HPA004345
• NACRES: NA.43

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• termékcsalád: Prestige Antibodies^® Powered by Atlas Antibodies
• form: buffered aqueous glycerol solution
• faj reaktivitás: human
• fejlettebb validálás: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• technika/technikák: immunoblotting: 0.04-0.4 μg/mL; immunofluorescence: 0.25-2 μg/mL; immunohistochemistry: 1:50-1:200
• immunogén szekvencia: MQPHLQRQHSNPGHAGPFPVVSVHNTTINPTSPTTATMANANRGPTSPSVTAIELIPSVTNPENLPSLPDIPPIQLEDAGSSSLDNLLSRYISGSHLPPQPTSTMNPSPGPSALSPGSSGLSNSHTPVRPPSTSSTGSR
• UniProt elérési szám: Q9UPN9
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... TRIM33(51592)

Leírás

Általános leírás

TRIM33 (Tripartite motif containing 33) is a transcriptional repressor belonging to the transcriptional intermediary factor 1 family.

Immunogen

E3 ubiquitin-protein ligase TRIM33 recombinant protein epitope signature tag (PrEST)

Alkalmazás

Anti-TRIM33 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biokémiai/fiziológiai hatások

TRIM33 (Tripartite motif containing 33) is directly involved in the regulation of tumor cell growth through TGF-β/Smad signaling cascade. In TGF-β/Smad signaling pathway, it binds to the receptor phosphorylated Smad2/3 to reflect differentiation response. It exhibits a strong silencing activity of gene expression in promoter attached condition. It functions as a biomarker in the progression of hepatocellular carcinoma (HCC). In HCC, TRIM33 plays an important role in the tumor growth at the early stage of HCC, but not in advanced form. On the other hand, it inhibits invasion and metastasis in both early and advanced-stage of HCC.

Tulajdonságok és előnyök

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST86693

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 1
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable
• Egyéni védőeszköz: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)