Ugrás a tartalomra
Merck
Összes fotó(2)

Fontos dokumentumok

HPA002320

Sigma-Aldrich

Anti-LMAN1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Szinonimák:

Anti-ER-Golgi intermediate compartment 53 kDa protein antibody produced in rabbit, Anti-ERGIC-53 protein precursor antibody produced in rabbit, Anti-Gp58 antibody produced in rabbit, Anti-Intracellular mannose-specific lectin MR60 antibody produced in rabbit, Anti-Lectin, mannose-binding 1 antibody produced in rabbit

Bejelentkezésa Szervezeti és Szerződéses árazás megtekintéséhez


About This Item

UNSPSC kód:
12352203
Human Protein Atlas-szám:
NACRES:
NA.41

biológiai forrás

rabbit

Minőségi szint

konjugátum

unconjugated

antitest forma

affinity isolated antibody

antitest terméktípus

primary antibodies

klón

polyclonal

termékcsalád

Prestige Antibodies® Powered by Atlas Antibodies

form

buffered aqueous glycerol solution

faj reaktivitás

human

technika/technikák

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

immunogén szekvencia

IGNNGQIHYDHQNDGASQALASCQRDFRNKPYPVRAKITYYQNTLTVMINNGFTPDKNDYEFCAKVENMIIPAQGHFGISAATGGLADDHDVLSFLTFQLTEPGKEP

UniProt elérési szám

kiszállítva

wet ice

tárolási hőmérséklet

−20°C

célzott transzláció utáni módosítás

unmodified

Géninformáció

human ... LMAN1(3998)

Általános leírás

Lectin mannose-binding 1 (LMAN1) is a mannose-specific, calcium-dependent lectin-like transport receptor protein.

Immunogen

ERGIC-53 protein precursor recombinant protein epitope signature tag (PrEST)

Alkalmazás

Anti-LMAN1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biokémiai/fiziológiai hatások

LMAN1 mediates intracellular transport of bidirectional glycoproteins from the endoplasmic reticulum to Golgi body. It interacts with cathepsin-Z-related proteins for the intracellular trafficking of the lysosomal enzyme cathepsin C and for efficient secretion of coagulation factors V and VIII. The efficiency of the gene in terms of expression level as well as recycling pathway is modulated by heat shock during cell stress. Heat shock enhances the translation of the LMAN1 mRNA followed by accumulation of LMAN1. Mutated LMAN1 leads to an autosomal recessive bleeding disorder i.e. combined deficiency of factor V and factor VIII (F5F8D). It has also been reported that abnormalities of LMAN1 potentially contribute to microsatellite instability (MSI)-H carcinogenesis.

Tulajdonságok és előnyök

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Kapcsolódás

Corresponding Antigen APREST86408

Fizikai forma

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Jogi információk

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Nem találja a megfelelő terméket?  

Próbálja ki a Termékválasztó eszköz. eszközt

kapcsolódó termék

Tárolási osztály kódja

10 - Combustible liquids

WGK

WGK 1

Lobbanási pont (F)

Not applicable

Lobbanási pont (C)

Not applicable

Egyéni védőeszköz

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Analitikai tanúsítványok (COA)

Analitikai tanúsítványok (COA) keresése a termék sarzs-/tételszámának megadásával. A sarzs- és tételszámok a termék címkéjén találhatók, a „Lot” vagy „Batch” szavak után.

Már rendelkezik ezzel a termékkel?

Az Ön által nemrégiben megvásárolt termékekre vonatkozó dokumentumokat a Dokumentumtárban találja.

Dokumentumtár megtekintése

Lili-Naz Hazrati et al.
Neurobiology of aging, 33(12), 2949-2949 (2012-07-24)
CR1 is a novel Alzheimer's disease (AD) gene identified by genome-wide association studies (GWAS). Recently, we showed that AD risk could be explained by an 18-kilobase insertion responsible for the complement component (3b/4b) receptor 1 (CR1)-S isoform. We investigated the
Carmen Spatuzza et al.
The Journal of biological chemistry, 279(41), 42535-42544 (2004-08-05)
ERGIC-53 is a lectin-like transport receptor protein, which recirculates between the ER and the Golgi complex and is required for the intracellular transport of a restricted number of glycoproteins. We show in this article that ERGIC-53 accumulates during the heat
Nina Roeckel et al.
Cancer research, 69(1), 292-299 (2009-01-02)
Glycosyl epitopes have been identified as tumor-specific markers in colorectal tumors and various lines of evidence indicate the significance of altered synthesis, transport, and secretion of glycoproteins in tumorigenesis. However, aberrant glycosylation has been largely ignored in microsatellite unstable (MSI-H)
Bin Zhang et al.
Nature genetics, 34(2), 220-225 (2003-04-30)
Mutations in LMAN1 (also called ERGIC-53) result in combined deficiency of factor V and factor VIII (F5F8D), an autosomal recessive bleeding disorder characterized by coordinate reduction of both clotting proteins. LMAN1 is a mannose-binding type 1 transmembrane protein localized to

Tudóscsoportunk valamennyi kutatási területen rendelkezik tapasztalattal, beleértve az élettudományt, az anyagtudományt, a kémiai szintézist, a kromatográfiát, az analitikát és még sok más területet.

Lépjen kapcsolatba a szaktanácsadással