AV47410

Anti-TMEM30A antibody produced in rabbit

affinity isolated antibody

• Szinonimák: Anti-C6orf67, Anti-CDC50A, Anti-FLJ10856, Anti-Transmembrane protein 30A
• UNSPSC kód: 12352203
• NACRES: NA.41

Tulajdonságok

• biológiai forrás: rabbit
• Minőségi szint: 100
• konjugátum: unconjugated
• antitest forma: affinity isolated antibody
• antitest terméktípus: primary antibodies
• klón: polyclonal
• form: buffered aqueous solution
• molekulatömeg: 41 kDa
• faj reaktivitás: human, dog, guinea pig, horse, rat, mouse
• koncentráció: 0.5 mg - 1 mg/mL
• technika/technikák: immunohistochemistry: suitable; western blot: suitable
• NCBI elérési szám: NP_060717
• UniProt elérési szám: Q9NV96
• kiszállítva: wet ice
• tárolási hőmérséklet: −20°C
• célzott transzláció utáni módosítás: unmodified
• Géninformáció: human ... TMEM30A(55754)

Leírás

Általános leírás

TMEM30A codes for a transmembrane protein that is present in the endoplasmic reticulum. Studies have reported that TMEM30A facilitates the import of bioactive and anticancer phospholipids into mammalian cells.
Rabbit Anti-TMEM30A recognizes human, mouse, rat, zebrafish, chicken, canine, and bovine TMEM30A.

Immunogen

Synthetic peptide directed towards the middle region of Human TMEM30A

Alkalmazás

Rabbit Anti-TMEM30A antibody is suitable for western blot applications at a concentration of 0.25 μg/ml and for immunohistochemistry at 4-8 μg/ml.

Biokémiai/fiziológiai hatások

The function of this protein remains unknown.

Szekvencia

Synthetic peptide located within the following region: FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Fizikai forma

Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.

Jogi nyilatkozat

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Biztonsági adatok

• Tárolási osztály kódja: 10 - Combustible liquids
• WGK: WGK 3
• Lobbanási pont (F): Not applicable
• Lobbanási pont (C): Not applicable