HPA010856

Anti-FXYD3 antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-Chloride conductance inducer protein Mat-8 antibody produced in rabbit, Anti-FXYD domain-containing ion transport regulator 3 precursor antibody produced in rabbit, Anti-Mammary tumor 8 kDa protein antibody produced in rabbit, Anti-Phospholemman-like antibody produced in rabbit
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA010856
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunohistochemistry: 1:20- 1:50
• sequência de imunogênio: MSEWRSSGEQAGRGWGSPPLTTQLSPTGAKCKCKFGQKSGHHPGETPPLITPGSAQS
• nº de adesão UniProt: Q14802
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... FXYD3(5349)

Descrição

Descrição geral

FXYD3 (FXYD domain containing ion transport regulator 3) belongs to the family of FXYD proteins, which form the conserved functional subunit of Na/K-ATPase. FXYD proteins are small, transmembrane proteins which span the membrane only once. They contain their characteristic FXYD (Phe-X-Tyr-Asp) motif as well as three conserved amino acid residues. This family consists of seven members which interact with Na/K-ATPase in a tissue-specific pattern. FXYD3 has two transmembrane domains instead of one, and also has its signal peptide intact. It is normally expressed in uterus, colon, skin and stomach. This protein has two isoforms- FXYD3a and FXYD3b, where FXYD3b has 26 more amino acids in its cytoplasmic region as compared to FXYD3a. This gene maps to human chromosome 19q13.12.

Imunogênio

FXYD domain-containing ion transport regulator 3 precursor recombinant protein epitope signature tag (PrEST)

Aplicação

Anti-FXYD3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Ações bioquímicas/fisiológicas

FXYD3 (FXYD domain containing ion transport regulator 3) regulates the transport of ions by interacting with and regulating the function of Na/K-ATPase. It either acts as a chloride channel or as a regulator of chloride channel. This protein is differentially expressed in many tumors, where it is overexpressed in prostate and pancreatic cancer, and down-regulated in colon and kidney cancer. Also, it is overexpressed in gastric adenocarcinoma, where it may be involved in tumorigenesis and metastasis. It is up-regulated in glioma, especially in cases of multiple gliomas and female patients. Therefore, it might play a role in glioma development. Down-regulation of FXYD3 might play a role in epithelial-mesenchymal transition, as in the case of lung cancer. It might act as a tumor suppressor, and its inactivation might result in the atypical morphology of cancer cells, as well as the progression of lung cancer.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST71685

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)