HPA001812

Anti-APOBEC3G antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

• Sinônimo(s): Anti-APOBEC-related cytidine deaminase antibody produced in rabbit, Anti-APOBEC-related protein antibody produced in rabbit, Anti-ARCD antibody produced in rabbit, Anti-ARP-9 antibody produced in rabbit, Anti-CEM-15 antibody produced in rabbit, Anti-CEM15 antibody produced in rabbit, Anti-DNA dC→dU-editing enzyme APOBEC-3G antibody produced in rabbit
• Código UNSPSC: 12352203
• Número do Atlas de Proteínas Humanas: HPA001812
• NACRES: NA.41

Propriedades

• fonte biológica: rabbit
• Nível de qualidade: 100
• conjugado: unconjugated
• forma do anticorpo: affinity isolated antibody
• tipo de produto de anticorpo: primary antibodies
• clone: polyclonal
• linha de produto: Prestige Antibodies^® Powered by Atlas Antibodies
• Formulário: buffered aqueous glycerol solution
• reatividade de espécies: human
• validação aprimorada: orthogonal RNAseq; orthogonal RNAseq; Learn more about Antibody Enhanced Validation
• técnica(s): immunohistochemistry: 1:200- 1:500
• sequência de imunogênio: MHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGCPFQPWDGLDEHSQDLSGRL
• nº de adesão UniProt: Q9HC16
• Condições de expedição: wet ice
• temperatura de armazenamento: −20°C
• modificação pós-traducional do alvo: unmodified
• Informações sobre genes: human ... APOBEC3G(60489)

Descrição

Descrição geral

APOBEC3G (apolipoprotein B messenger-RNA-editing enzyme, catalytic polypeptide-like 3G) belongs to the APOBEC family of cytidine deaminases. It is expressed predominantly in cytoplasmic region. It is localized in pyramidal neurons within the gray matter of cerebral and cerebellar cortices. It has a core α-β-α fold structure for catalytic activity. The five-stranded β-sheet is surrounded on both sides by six α-helices arranged over a hydrophobic platform.

Imunogênio

DNA dC→dU-editing enzyme APOBEC-3G recombinant protein epitope signature tag (PrEST)

Aplicação

Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below.
Immunohistochemistry (1 paper)

Ações bioquímicas/fisiológicas

APOBEC3G (apolipoprotein B mRNA editing enzyme catalytic subunit 3G) is associated with diverse biological functions such as mRNA editing, inhibiting the mobilization of retroviruses and retrotransposons, including the inhibition of human immunodeficiency virus-1 (HIV-1) replication. It can restrict HIV-1 infectivity during reverse transcription, by inserting in viral particles and deaminating the viral cDNA cytidines to uridines. The deaminated uridines mutate the DNA strand to generate stop codons for the inactivation of the virus. However, with the help of viral Vif protein HIV-1 can counteracts APOBEC3G by protosomal degradation.

Características e benefícios

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Ligação

Corresponding Antigen APREST73531

forma física

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informações legais

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Exoneração de responsabilidade

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

Informações de segurança

• Código de classe de armazenamento: 10 - Combustible liquids
• Classe de risco de água (WGK): WGK 1
• Ponto de fulgor (°F): Not applicable
• Ponto de fulgor (°C): Not applicable
• Equipamento de proteção individual: Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)