HPA021002

Anti-HIBADH antibody produced in rabbit

Prestige Antibodies^® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution, Ab2

• Synonym(e): Anti-3-hydroxyisobutyrate dehydrogenase, mitochondrial, Anti-HIBADH
• UNSPSC-Code: 12352203
• Human Protein Atlas-Nummer: HPA021002
• NACRES: NA.41

Eigenschaften

• Biologische Quelle: rabbit
• Konjugat: unconjugated
• Antikörperform: affinity isolated antibody
• Antikörper-Produkttyp: primary antibodies
• Klon: polyclonal
• Produktlinie: Prestige Antibodies^® Powered by Atlas Antibodies
• Form: buffered aqueous glycerol solution
• Speziesreaktivität: human
• Erweiterte Validierung: independent; Learn more about Antibody Enhanced Validation
• Methode(n): immunoblotting: 0.04-0.4 μg/mL; immunohistochemistry: 1:50-1:200
• Immunogene Sequenz: NPVPGVMDGVPSANNYQGGFGTTLMAKDLGLAQDSATSTKSPILLGSLAHQIYRMMCAKGYSKKDFSSVFQFLR
• UniProt-Hinterlegungsnummer: P31937
• Versandbedingung: wet ice
• Lagertemp.: −20°C
• Posttranslationale Modifikation Target: unmodified
• Angaben zum Gen: human ... HIBADH(11112)

Beschreibung

Allgemeine Beschreibung

The gene HIBADH (3-hydroxyisobutyrate dehydrogenase, mitochondrial) is mapped to human chromosome 7p15.2-p14.3. HIBADH transcripts are present in the cerebellum, heart, skeletal muscle, uterus, placenta and testis. The protein is expressed in the placenta, testis and spermatozoa. HIBADH mainly localizes in the mitochondria.

Immunogen

3-hydroxyisobutyrate dehydrogenase, mitochondrial Precursor recombinant protein epitope signature tag (PrEST)

Anwendung

Anti-HIBADH antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.

Biochem./physiol. Wirkung

HIBADH (3-hydroxyisobutyrate dehydrogenase, mitochondrial) is responsible for amino-acids metabolism in the gluconeogenesis pathway, and thus generates glucose. The identified substrates of HIBADH are 3-hydroxy-2-methylpropanoate and NAD⁺ (nicotinamide adenine dinucleotide). It is involved in valine, leucine and isoleucine degradation. HIBADH is suggested to participate in the mitochondrial function of spermatozoa, and thereby regulates sperm motility.

Leistungsmerkmale und Vorteile

Prestige Antibodies^® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies^® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:

• IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
• Protein array of 364 human recombinant protein fragments.

Verlinkung

Corresponding Antigen APREST74906

Physikalische Form

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Rechtliche Hinweise

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany

Sicherheitshinweise

• Lagerklassenschlüssel: 10 - Combustible liquids
• WGK: WGK 1
• Flammpunkt (°F): Not applicable
• Flammpunkt (°C): Not applicable