WH0055288M1
Monoclonal Anti-RHOT1 antibody produced in mouse
clone 4H4, purified immunoglobulin, buffered aqueous solution
Synonim(y):
Anti-ARHT1, Anti-FLJ11040, Anti-FLJ12633, Anti-MIRO1, Anti-ras homolog gene family, member T1
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
Wybierz wielkość
100 μG
2220,00 zł
2220,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1674
Wybierz wielkość
Zmień widok
100 μG
2220,00 zł
About This Item
Kod UNSPSC:
12352203
NACRES:
NA.41
2220,00 zł
Skontaktuj się z Obsługą Klienta, aby uzyskać informacje na temat dostępności
Rekombinowane, niezawierające konserwantów przeciwciało jest dostępne dla Twojego celu. Wypróbuj ZRB1674
Polecane produkty
pochodzenie biologiczne
mouse
Poziom jakości
białko sprzężone
unconjugated
forma przeciwciała
purified immunoglobulin
rodzaj przeciwciała
primary antibodies
klon
4H4, monoclonal
Formularz
buffered aqueous solution
reaktywność gatunkowa
human
metody
indirect ELISA: suitable
western blot: 1-5 μg/mL
izotyp
IgG1κ
numer dostępu GenBank
numer dostępu UniProt
Warunki transportu
dry ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... RHOT1(55288)
Powiązane kategorie
Opis ogólny
Ras homolog family member T1 (RHOT1) is encoded by the gene mapped to human chromosome 17q11.2. RhoT1 is a member of mitochondrial Rho GTPase family.
Immunogen
RHOT1 (NP_060777, 483 a.a. ~ 580 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Sequence
TEAEIICDVVCLVYDVSNPKSFEYCARIFKQHFMDSRIPCLIVAAKSDLHEVKQEYSISPTDFCRKHKMPPPQAFTCNTADAPSKDIFVKLTTMAMYP
Działania biochem./fizjol.
Ras homolog family member T1 (RHOT1) plays an essential role in controlling mitochondrial homeostasis and apoptosis. RHOT1 serves as a tumor suppressor gene for pancreatic cancer (PC), and it can be considered as a potential prognostic biomarker for overall survival and as a promising therapeutic target for PC. Decreased expression of RHOT1 might result in lymph node metastasis (LNM) and shorter survival. RHOT1 has a crucial role to play in mitochondrial transport, lymphocyte migration, and polarity.
Postać fizyczna
Solution in phosphate buffered saline, pH 7.4
Informacje prawne
GenBank is a registered trademark of United States Department of Health and Human Services
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
Ta strona może zawierać tekst przetłumaczony maszynowo.
Nie możesz znaleźć właściwego produktu?
Wypróbuj nasz Narzędzie selektora produktów.
polecane
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
nwg
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Wybierz jedną z najnowszych wersji:
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Klienci oglądali również te produkty
Pei-I Tsai et al.
Molecular biology of the cell, 28(24), 3471-3479 (2017-09-15)
MIC60/mitofilin constitutes a hetero-oligomeric complex on the inner mitochondrial membranes to maintain crista structure. However, little is known about its physiological functions. Here, by characterizing
Renu Bajaj et al.
Molecular cytogenetics, 4, 3-3 (2011-01-22)
To evaluate the clinical validity of genome-wide oligonucleotide array comparative genomic hybridization (aCGH) for detecting somatic abnormalities, we have applied this genomic analysis to 30 cases (13 MDS and 17 AML) with clonal chromosomal abnormalities detected in more than 50%
RhoT1 and Smad4 are correlated with lymph node metastasis and overall survival in pancreatic cancer.
Hua Jiang et al.
PloS one, 7(7), e42234-e42234 (2012-08-04)
Cancer cell invasion and metastasis are the most important adverse prognostic factors for pancreatic cancer. Identification of biomarkers associated with outcome of pancreatic cancer may provide new approaches and targets for anticancer therapy. The aim of this study is to
Clara Berenguer-Escuder et al.
Journal of clinical medicine, 8(12) (2020-01-01)
Although most cases of Parkinson´s disease (PD) are idiopathic with unknown cause, an increasing number of genes and genetic risk factors have been discovered that play a role in PD pathogenesis. Many of the PD-associated proteins are involved in mitochondrial
Fei Wang et al.
EMBO reports, 22(7), e52006-e52006 (2021-06-08)
Tunneling nanotubes (TNTs) are actin-rich structures that connect two or more cells and mediate cargo exchange between spatially separated cells. TNTs transport signaling molecules, vesicles, organelles, and even pathogens. However, the molecular mechanisms regulating TNT formation remain unclear and little
Active Filters
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej
