SAB1404511

Monoclonal Anti-UCP1 antibody produced in mouse

clone 4B7, purified immunoglobulin, buffered aqueous solution

• Synonim(y): SLC25A7, UCP
• Kod UNSPSC: 12352203
• NACRES: NA.41

Właściwości

• pochodzenie biologiczne: mouse
• białko sprzężone: unconjugated
• forma przeciwciała: purified immunoglobulin
• rodzaj przeciwciała: primary antibodies
• klon: 4B7, monoclonal
• Postać: buffered aqueous solution
• masa cząsteczkowa: antigen ~30.07 kDa
• reaktywność gatunkowa: human, mouse
• metody: capture ELISA: suitable; indirect ELISA: suitable; western blot: 1-5 μg/mL
• izotyp: IgG2aκ
• numer dostępu NCBI: NM_021833
• numer dostępu UniProt: P25874
• Warunki transportu: dry ice
• temp. przechowywania: −20°C
• docelowa modyfikacja potranslacyjna: unmodified
• informacje o genach: human ... UCP1(7350)

Opis

Opis ogólny

Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. (provided by RefSeq)

Immunogen

UCP1 (NP_068605, 232 a.a. ~ 267 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.

This page may contain text that has been machine translated.

Informacja o środkach bezpieczeństwa

• Kod klasy składowania: 10 - Combustible liquids
• Klasa zagrożenia wodnego (WGK): WGK 1