Przejdź do zawartości
Merck

SAB1401263

Sigma-Aldrich

Monoclonal Anti-NFIX antibody produced in mouse

clone 3D2, purified immunoglobulin, buffered aqueous solution

Synonim(y):

NF1A

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
NACRES:
NA.41

pochodzenie biologiczne

mouse

białko sprzężone

unconjugated

forma przeciwciała

purified immunoglobulin

rodzaj przeciwciała

primary antibodies

klon

3D2, monoclonal

Postać

buffered aqueous solution

reaktywność gatunkowa

human

metody

capture ELISA: suitable
western blot: 1-5 μg/mL

izotyp

IgG2aκ

numer dostępu NCBI

numer dostępu UniProt

Warunki transportu

dry ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... NFIX(4784)

Opis ogólny

Nuclear factor I X (NFIX) is encoded by the gene mapped to human chromosome 19p13.13. The encoded protein is a member of the nuclear factor one (NFI) family of transcription factors.

Immunogen

NFIX (NP_002492.2, 291 a.a. ~ 390 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
DDVFYPGTGRSPAAGSSQSSGWPNDVDAGPASLKKSGKLDFCSALSSQGSSPRMAFTHHPLPVLAGVRPGSPRATASALHFPSTSIIQQSSPYFTHPTIR

Zastosowanie

Monoclonal Anti-NFIX antibody produced in mouse has been used in chromatin immunoprecipitation (ChIP) and immunofluorescence (IF).

Działania biochem./fizjol.

Nuclear factor I X (NFIX) plays a vital role in normal brain and skeletal development. The encoded protein regulates c-Mpl (thrombopoietin receptor) transcription and promote survival of hematopoietic stem and progenitor cells (HSPCs). Mutation in the gene has been observed in Sotos-like features and Marshall–Smith syndrome patients.

Postać fizyczna

Solution in phosphate buffered saline, pH 7.4

Oświadczenie o zrzeczeniu się odpowiedzialności

Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

A novel microdeletion/microduplication syndrome of 19p13. 13.
Dolan M, et al.
Genetics in Medicine : Official Journal of the American College of Medical Genetics, 12(8), 503-503 (2010)
Array?CGH detection of a de novo 0.7?Mb deletion in 19p13.13 including CACNA1A associated with mental retardation and epilepsy with infantile spasms
Auvin S, et al.
Epilepsia, 50(11), 2501-2503 (2009)
Transcriptional regulation of ependymal cell maturation within the postnatal brain
Vidovic D, et al.
Neural Dev., 13(1), 2-2 (2018)
Nfix Promotes Survival of Immature Hematopoietic Cells via Regulation of c-Mpl.
Hall T, et al.
Stem Cells (2018)
Distinct Effects of Allelic NFIX Mutations on Nonsense-Mediated mRNA Decay Engender Either a Sotos-like or a Marshall-Smith Syndrome
Malan V, et al.
American Journal of Human Genetics, 87(2), 189-198 (2010)

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej