Przejdź do zawartości
Merck
Wszystkie zdjęcia(5)

Kluczowe dokumenty

HPA014765

Sigma-Aldrich

Anti-ITPR1 antibody produced in rabbit

Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution

Synonim(y):

Anti-ACV, Anti-IP3R1, Anti-Insp3r1, Anti-PPP1R94, Anti-SCA15, Anti-SCA16, Anti-SCA29

Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych


About This Item

Kod UNSPSC:
12352203
Numer w atlasie ludzkich białek:
NACRES:
NA.41

pochodzenie biologiczne

rabbit

Poziom jakości

białko sprzężone

unconjugated

forma przeciwciała

affinity isolated antibody

rodzaj przeciwciała

primary antibodies

klon

polyclonal

linia produktu

Prestige Antibodies® Powered by Atlas Antibodies

Postać

buffered aqueous glycerol solution

reaktywność gatunkowa

human

metody

immunoblotting: 0.04-0.4 μg/mL
immunohistochemistry: 1:500-1:1000

sekwencja immunogenna

KDDFILEVDRLPNETAVPETGESLASEFLFSDVCRVESGENCSSPAPREELVPAEETEQDKEHTCETLLMCIVTVLSHGLRS

numer dostępu UniProt

Warunki transportu

wet ice

temp. przechowywania

−20°C

docelowa modyfikacja potranslacyjna

unmodified

informacje o genach

human ... ITPR1(3708)

Opis ogólny

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a ligand-gated calcium channel, which is present in the endoplasmic reticulum (ER). It either acts as a homotetarmer or forms heterotetramer with type 2 or type 3 inositol 1,4,5-trisphosphate receptors. It is highly expressed in the central nervous system, especially in the Purkinje cells of the cerebellum. This channel contains a coupling/regulatory domain, which consists of phosphorylation sites, a proteolytic cleavage region, ATP-binding sites, and binding sites for multiple proteins. This gene is localized to human chromosome 3p26.

Immunogen

Inositol 1,4,5-trisphosphate receptor type 1 recombinant protein epitope signature tag (PrEST)

Zastosowanie

All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

The Human Protein Atlas project can be subdivided into three efforts: Human Tissue Atlas, Cancer Atlas, and Human Cell Atlas. The antibodies that have been generated in support of the Tissue and Cancer Atlas projects have been tested by immunohistochemistry against hundreds of normal and disease tissues and through the recent efforts of the Human Cell Atlas project, many have been characterized by immunofluorescence to map the human proteome not only at the tissue level but now at the subcellular level. These images and the collection of this vast data set can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. We also provide Prestige Antibodies® protocols and other useful information.

Działania biochem./fizjol.

ITPR1 (inositol 1,4,5-trisphosphate receptor, type 1) is a Ca2+-channel, which is activated upon binding by inositol 1,4,5-trisphosphate (IP3), and releases Ca2+ from endoplasmic reticulum (ER) into the cytoplasm. This released calcium participates in various Ca2+-dependent signaling and cellular processes. It is activated on death receptor binding or cellular damage, and regulates intracellular calcium levels during apoptosis. Heterozygous deletion in this gene is responsible for the autosomal dominant neurodegenerative disorder spinocerebellar ataxia type 15 (SCA15), which is characterized by late-onset, slow-progressive cerebellar ataxia. It is involved in the activation of T-cells, where it gets phosphorylated at Y353 residue, located at the IP3-binding domain. It plays an essential role in the initial stages of myoblast differentiation, where it induces the expression of myogenin and MEF2 (myocyte enhancer factor 2), which are transcription factors specific to muscles. ITPR1 is also essential for development and maintenance of cerebellum.

Cechy i korzyści

Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.

Every Prestige Antibody is tested in the following ways:
  • IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
  • Protein array of 364 human recombinant protein fragments.

Powiązanie

Corresponding Antigen APREST73267

Postać fizyczna

Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide

Informacje prawne

Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Ta strona może zawierać tekst przetłumaczony maszynowo.

Nie możesz znaleźć właściwego produktu?  

Wypróbuj nasz Narzędzie selektora produktów.

Kod klasy składowania

10 - Combustible liquids

Klasa zagrożenia wodnego (WGK)

WGK 1

Temperatura zapłonu (°F)

Not applicable

Temperatura zapłonu (°C)

Not applicable

Środki ochrony indywidualnej

Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)


Certyfikaty analizy (CoA)

Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.

Masz już ten produkt?

Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.

Odwiedź Bibliotekę dokumentów

Lijia Huang et al.
Orphanet journal of rare diseases, 7, 67-67 (2012-09-19)
Congenital nonprogressive spinocerebellar ataxia is characterized by early gross motor delay, hypotonia, gait ataxia, mild dysarthria and dysmetria. The clinical presentation remains fairly stable and may be associated with cerebellar atrophy. To date, only a few families with autosomal dominant
Nikhil deSouza et al.
The Journal of cell biology, 179(5), 923-934 (2007-12-07)
Sustained elevation of intracellular calcium by Ca2+ release-activated Ca2+ channels is required for lymphocyte activation. Sustained Ca2+ entry requires endoplasmic reticulum (ER) Ca2+ depletion and prolonged activation of inositol 1,4,5-trisphosphate receptor (IP(3)R)/Ca2+ release channels. However, a major isoform in lymphocyte
Camia Steinmann et al.
The Journal of biological chemistry, 283(20), 13506-13509 (2008-03-28)
Tumor cells strategically down-regulate Fas receptor expression to evade immune attack and up-regulate expression of Fas ligand to promote apoptosis of infiltrating T lymphocytes. Many pathways leading to apoptotic cell death require calcium release from inositol 1,4,5-trisphosphate receptors (IP3Rs). Here
Fabrice Antigny et al.
Cell calcium, 56(6), 513-521 (2014-12-04)
Cytosolic Ca(2+) signals are fundamental for the early and late steps of myoblast differentiation and are, as in many cells, generated by Ca(2+) release from internal stores as well as by plasma membrane Ca(2+) entry. Our recent studies identified the
Margaret P Adam et al.
GeneReviews(?), 2006 May 30 (Updated 2014 Jun 12) (2014-06-12)
Spinocerebellar ataxia type 15 (SCA15) is characterized by slowly progressive gait and limb ataxia, often in combination with ataxic dysarthria, titubation, upper limb postural tremor, mild hyperreflexia, gaze-evoked nystagmus, and impaired vestibuloocular reflex gain. Onset is between ages seven and

Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.

Skontaktuj się z zespołem ds. pomocy technicznej