HPA003157
Anti-BGN antibody produced in rabbit
Prestige Antibodies® Powered by Atlas Antibodies, affinity isolated antibody, buffered aqueous glycerol solution
Synonim(y):
Anti-Biglycan precursor antibody produced in rabbit, Anti-Bone/cartilage proteoglycan I antibody produced in rabbit, Anti-PG-S1 antibody produced in rabbit
Zaloguj sięWyświetlanie cen organizacyjnych i kontraktowych
About This Item
Polecane produkty
pochodzenie biologiczne
rabbit
białko sprzężone
unconjugated
forma przeciwciała
affinity isolated antibody
rodzaj przeciwciała
primary antibodies
klon
polyclonal
linia produktu
Prestige Antibodies® Powered by Atlas Antibodies
Postać
buffered aqueous glycerol solution
reaktywność gatunkowa
human
rozszerzona walidacja
orthogonal RNAseq
recombinant expression
Learn more about Antibody Enhanced Validation
metody
immunoblotting: 0.04-0.4 μg/mL
immunofluorescence: 0.25-2 μg/mL
immunohistochemistry: 1:500-1:1000
sekwencja immunogenna
RGFWDFTLDDGPFMMNDEEASGADTSGVLDPDSVTPTYSAMCPFGCHCHLRVVQCSDLGLKSVPKEISPDTTLLDLQNNDISELRKDDFKGLQHLYALVLVNNKISKIHEKAFSPLRKLQKLYISKNHLVEIPPNLPSSL
numer dostępu UniProt
Zastosowanie
research pathology
Warunki transportu
wet ice
temp. przechowywania
−20°C
docelowa modyfikacja potranslacyjna
unmodified
informacje o genach
human ... BGN(633)
Opis ogólny
BGN (biglycan), also called proteoglycan I (PGI), which belongs to the family of proteoglycans called small leucine-rich proteoglycan (SLRP). This protein is composed of characteristic leucine-rich repeat motifs located centrally. These motifs are linked by disulfide bond stabilized loops. It is predominantly expressed in tissues of mesenchymal type, and is found in the cell surface or in the pericellular matrix.
Immunogen
Biglycan precursor recombinant protein epitope signature tag (PrEST)
Zastosowanie
Anti-BGN antibody produced in rabbit is suitable for use in measuring the concentration of biglycan by sandwich ELISA method.
Anti-BGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Anti-BGN antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by immunohistochemistry against hundreds of normal and disease tissues. These images can be viewed on the Human Protein Atlas (HPA) site by clicking on the Image Gallery link. The antibodies are also tested using immunofluorescence and western blotting. To view these protocols and other useful information about Prestige Antibodies and the HPA, visit sigma.com/prestige.
Działania biochem./fizjol.
BGN (biglycan) gene encodes a leucine-rich, pericellular matrix proteoglycan that functions in the assembly of collagen fibrils and muscle regeneration. It belongs to the decorin family of proteins and contains two chains of chondroitin sulfate. It interacts with transforming growth factor β and may function in regulating its activities. The distribution of this protein indicates that it may be involved in the physiology of the neuromuscular junction, and morphogenesis and differentiation of tissues. The protein functions as an endogenous ligand for Toll-like receptors, TLR4 and TLR2, that are involved in innate immunity. It enhances inflammation via TLR4 and TLR2 signaling, leading to the synthesis of TNF-α (Tumor necrosis factor-α) and MIP-2 (macrophage inflammatory protein-2).
Cechy i korzyści
Prestige Antibodies® are highly characterized and extensively validated antibodies with the added benefit of all available characterization data for each target being accessible via the Human Protein Atlas portal linked just below the product name at the top of this page. The uniqueness and low cross-reactivity of the Prestige Antibodies® to other proteins are due to a thorough selection of antigen regions, affinity purification, and stringent selection. Prestige antigen controls are available for every corresponding Prestige Antibody and can be found in the linkage section.
Every Prestige Antibody is tested in the following ways:
Every Prestige Antibody is tested in the following ways:
- IHC tissue array of 44 normal human tissues and 20 of the most common cancer type tissues.
- Protein array of 364 human recombinant protein fragments.
Powiązanie
Corresponding Antigen APREST74436
Postać fizyczna
Solution in phosphate-buffered saline, pH 7.2, containing 40% glycerol and 0.02% sodium azide
Informacje prawne
Prestige Antibodies is a registered trademark of Merck KGaA, Darmstadt, Germany
Oświadczenie o zrzeczeniu się odpowiedzialności
Unless otherwise stated in our catalog or other company documentation accompanying the product(s), our products are intended for research use only and are not to be used for any other purpose, which includes but is not limited to, unauthorized commercial uses, in vitro diagnostic uses, ex vivo or in vivo therapeutic uses or any type of consumption or application to humans or animals.
This page may contain text that has been machine translated.
Not finding the right product?
Try our Narzędzie selektora produktów.
Kod klasy składowania
10 - Combustible liquids
Klasa zagrożenia wodnego (WGK)
WGK 1
Temperatura zapłonu (°F)
Not applicable
Temperatura zapłonu (°C)
Not applicable
Środki ochrony indywidualnej
Eyeshields, Gloves, multi-purpose combination respirator cartridge (US)
Certyfikaty analizy (CoA)
Poszukaj Certyfikaty analizy (CoA), wpisując numer partii/serii produktów. Numery serii i partii można znaleźć na etykiecie produktu po słowach „seria” lub „partia”.
Masz już ten produkt?
Dokumenty związane z niedawno zakupionymi produktami zostały zamieszczone w Bibliotece dokumentów.
Single-cell mapping reveals new markers and functions of lymphatic endothelial cells in lymph nodes.
Noriki Fujimoto et al.
PLoS biology, 18(4), e3000704-e3000704 (2020-04-07)
Lymph nodes (LNs) are highly organized secondary lymphoid organs that mediate adaptive immune responses to antigens delivered via afferent lymphatic vessels. Lymphatic endothelial cells (LECs) line intranodal lymphatic sinuses and organize lymph and antigen distribution. LECs also directly regulate T
Vida Kocbek et al.
Gynecological endocrinology : the official journal of the International Society of Gynecological Endocrinology, 30(7), 520-524 (2014-03-20)
In our previous low-density-array gene-expression analysis we found an increased expression of biglycan gene in ovarian endometriosis patients. In the present study we evaluated biglycan expression at the protein level in tissue, serum and peritoneal fluid (PF) from ovarian endometriosis
Frank Jacobsen et al.
Neoplasia (New York, N.Y.), 19(9), 707-715 (2017-08-23)
Biglycan (BGN), a proteoglycan of the extracellular matrix, is included in mRNA signatures for prostate cancer aggressiveness. To understand the impact of BGN on prognosis and its relationship to molecularly defined subsets, we analyzed BGN expression by immunohistochemistry on a
Ying-Hui Zhu et al.
International journal of clinical and experimental pathology, 6(11), 2497-2505 (2013-11-15)
Biglycan (BGN), an extracellular matrix component, has been reported to play a crucial role in the tumor progression of various cancers. However, the relation between the expression of BGN and clinical prognosis has not been studied yet. We therefore carry
Ana Paula Thiesen et al.
PloS one, 18(3), e0282176-e0282176 (2023-03-28)
New breast cancer biomarkers have been sought for better tumor characterization and treatment. Among these putative markers, there is Biglycan (BGN). BGN is a class I small leucine-rich proteoglycan family of proteins characterized by a protein core with leucine-rich repeats.
Produkty
Glycosaminoglycans are large linear polysaccharides constructed of repeating disaccharide units.
Nasz zespół naukowców ma doświadczenie we wszystkich obszarach badań, w tym w naukach przyrodniczych, materiałoznawstwie, syntezie chemicznej, chromatografii, analityce i wielu innych dziedzinach.
Skontaktuj się z zespołem ds. pomocy technicznej