SAB1412026

ANTI-EPHB2 antibody produced in mouse

clone 1F10, ascites fluid

• Sinonimo/i: CAPB, DRT, EPHB2, EPHT3, ERK
• Codice UNSPSC: 12352203
• NACRES: NA.41

Proprietà

• Origine biologica: mouse
• Coniugato: unconjugated
• Forma dell’anticorpo: ascites fluid
• Tipo di anticorpo: primary antibodies
• Clone: 1F10, monoclonal
• PM: antigen 36.63 kDa
• Reattività contro le specie: human
• tecniche: indirect ELISA: suitable; western blot: 1:500-1:1000
• Isotipo: IgMκ
• N° accesso NCBI: NM_017449
• N° accesso UniProt: P29323
• Condizioni di spedizione: dry ice
• Temperatura di conservazione: −20°C
• modifica post-traduzionali bersaglio: unmodified
• Informazioni sul gene: human ... EPHB2(2048)

Descrizione

Descrizione generale

Ephrin receptors and their ligands, the ephrins, mediate numerous developmental processes, particularly in the nervous system. Based on their structures and sequence relationships, ephrins are divided into the ephrin-A (EFNA) class, which are anchored to the membrane by a glycosylphosphatidylinositol linkage, and the ephrin-B (EFNB) class, which are transmembrane proteins. The Eph family of receptors are divided into 2 groups based on the similarity of their extracellular domain sequences and their affinities for binding ephrin-A and ephrin-B ligands. Ephrin receptors make up the largest subgroup of the receptor tyrosine kinase (RTK) family. The protein encoded by this gene is a receptor for ephrin-B family members. (provided by RefSeq)

Immunogeno

EPHB2 (NP_059145, 226 a.a. ~ 325 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Sequence
CIANAEEVDVPIKLYCNGDGEWLVPIGRCMCKAGFEAVENGTVCRGCPSGTFKANQGDEACTHCPINSRTTSEGATNCVCRNGYYRADLDPLDMPCTTIP

Stato fisico

Clear solution

Informazioni sulla sicurezza

• Codice della classe di stoccaggio: 10 - Combustible liquids
• Classe di pericolosità dell'acqua (WGK): WGK 3
• Punto d’infiammabilità (°F): Not applicable
• Punto d’infiammabilità (°C): Not applicable